PAX3 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PAX3 |
PAX3 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PAX3 |
Rabbit polyclonal PAX3 Antibody (N-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PAX3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 98-126 amino acids from the N-terminal region of human PAX3. |
Rabbit Polyclonal Anti-PAX3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PAX3 antibody: synthetic peptide directed towards the C terminal of human PAX3. Synthetic peptide located within the following region: GGVPHQPQTDYALSPLTGGLEPTTTVSASCSQRLDHMKSLDSLPTSQSYC |
Goat Polyclonal Antibody against PAX3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence TTLAGAVPRMM-C, from the N Terminus of the protein sequence according to NP_000429.2; NP_039230.1; NP_852122;.1 NP_852123.1; NP_852124.1; NP_852125.1; NP_852126.1. |