Rabbit Monoclonal antibody against Gli-1 (GLI1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Monoclonal antibody against Gli-1 (GLI1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Gli1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human Gli1 protein (between residues 150-200) [UniProt P08151] |
BMP2 (aa 261-290) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 261-290 of Human BMP2. |
BMP4 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Chicken, Human, Mouse, Rabbit, Rat |
Immunogen | Synthetic peptide surrounding amino acid 395 of Human BMP-4 |
Rabbit polyclonal anti-Gli-3 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Chimpanzee, Squirrel Monkey, Xenopus, Chicken, Dog |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was produced from monospecific rabbit serum by repeated immunizations with a synthetic peptide corresponding to amino acids 41-57 of human Gli-3 protein. |
Rabbit Polyclonal BMP-2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of human BMP2 (within residues 250-350) [Swiss-Prot# P12643] |
Rabbit Polyclonal anti-GLI2 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GLI2 antibody: synthetic peptide directed towards the N terminal of human GLI2. Synthetic peptide located within the following region: RNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTE |
Rabbit Polyclonal GLI-2 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human Gli2 protein (between residues 300-400) [UniProt P10070] |
Rabbit polyclonal anti-GLI-3 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human GLI-3. |
Anti-Human BMP-2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human BMP-2 |
Carrier-free (BSA/glycerol-free) Purified GLI1 mouse monoclonal antibody, clone OTI2D5E2
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GLI1 mouse monoclonal antibody, clone OTI2E5 (formerly 2E5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GLI1 mouse monoclonal antibody, clone OTI4C1 (formerly 4C1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GLI1 mouse monoclonal antibody, clone OTI4E2 (formerly 4E2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GLI1 mouse monoclonal antibody, clone OTI4A8 (formerly 4A8)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GLI1 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GLI1 mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GLI2 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Anti-BMP4 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 293-408 amino acids of human bone morphogenetic protein 4 |
Anti-BMP4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 293-408 amino acids of human bone morphogenetic protein 4 |
GLI3 Antibody
Applications | IHC |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence KPDEDLPSPGARGQQEQPEGTTLVKEEGDKDESKQEPEVIYETNCHWEGC |
Purified GLI1 mouse monoclonal antibody, clone OTI2D5E2
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Purified GLI1 mouse monoclonal antibody, clone OTI2D5E2, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Purified GLI1 mouse monoclonal antibody, clone OTI2D5E2, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Purified GLI1 mouse monoclonal antibody, clone OTI2D5E2
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GLI1 mouse monoclonal antibody, clone OTI2E5 (formerly 2E5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GLI1 mouse monoclonal antibody, clone OTI2E5 (formerly 2E5), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
GLI1 mouse monoclonal antibody, clone OTI2E5 (formerly 2E5), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
GLI1 mouse monoclonal antibody, clone OTI2E5 (formerly 2E5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GLI1 mouse monoclonal antibody, clone OTI4C1 (formerly 4C1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GLI1 mouse monoclonal antibody, clone OTI4C1 (formerly 4C1), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
GLI1 mouse monoclonal antibody, clone OTI4C1 (formerly 4C1), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
GLI1 mouse monoclonal antibody, clone OTI4C1 (formerly 4C1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GLI1 mouse monoclonal antibody, clone OTI4E2 (formerly 4E2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GLI1 mouse monoclonal antibody, clone OTI4E2 (formerly 4E2), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
GLI1 mouse monoclonal antibody, clone OTI4E2 (formerly 4E2), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
GLI1 mouse monoclonal antibody, clone OTI4E2 (formerly 4E2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GLI1 mouse monoclonal antibody, clone OTI4A8 (formerly 4A8)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GLI1 mouse monoclonal antibody, clone OTI4A8 (formerly 4A8), Biotinylated
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
GLI1 mouse monoclonal antibody, clone OTI4A8 (formerly 4A8), HRP conjugated
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
GLI1 mouse monoclonal antibody, clone OTI4A8 (formerly 4A8)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GLI1 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GLI1 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
GLI1 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
GLI1 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GLI1 mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GLI1 mouse monoclonal antibody, clone OTI1C1 (formerly 1C1), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
GLI1 mouse monoclonal antibody, clone OTI1C1 (formerly 1C1), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
GLI1 mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GLI2 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |