Antibodies

Jump to Filters
View as table Download
GATA6 Mouse Monoclonal Antibody [Clone ID: OTI2B3]
TA500186

USD 379.00

In Stock

GATA6 mouse monoclonal antibody, clone OTI2B3 (formerly 2B3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
GATA6 Rabbit Polyclonal Antibody
TA329425

USD 375.00

5 Days

Rabbit Polyclonal anti-GATA6 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GATA6 antibody: synthetic peptide directed towards the middle region of human GATA6. Synthetic peptide located within the following region: SGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDS
GATA6 Rabbit Polyclonal Antibody
TA321695

USD 345.00

In Stock

Anti-GATA6 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 9-23 amino acids of Human GATA binding protein 6
GATA6 Rabbit Polyclonal Antibody
TA321696

USD 345.00

In Stock

Anti-GATA6 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 9-23 amino acids of Human GATA binding protein 7
GATA6 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B3]
TA500186BM

USD 420.00

4 Weeks

GATA6 mouse monoclonal antibody, clone OTI2B3 (formerly 2B3), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
GATA6 Mouse Monoclonal Antibody [Clone ID: OTI2B3]
TA500186S

USD 159.00

In Stock

GATA6 mouse monoclonal antibody, clone OTI2B3 (formerly 2B3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

Special Offer: Get this product for $99/€99. Use code: "Truesample".