Antibodies

Jump to Filters
View as table Download
SOX10 Mouse Monoclonal Antibody [Clone ID: 1E6]
AM31703PU-N

USD 480.00

2 Weeks

SOX10 mouse monoclonal antibody, clone 1E6, Purified

Applications ELISA, IHC, WB
Reactivities Human
SOX10 Rabbit Polyclonal Antibody
TA333906

USD 375.00

5 Days

Rabbit Polyclonal Anti-SOX10 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SOX10 Antibody: synthetic peptide directed towards the middle region of human SOX10. Synthetic peptide located within the following region: PGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPT
SOX10 Rabbit Polyclonal Antibody
TA355017

USD 430.00

5 Days

Rabbit Polyclonal Anti-SOX10 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SOX10 antibody was raised against a peptide corresponding to 18 amino acids near the amino terminus of human SOX10.