Antibodies

View as table Download

Rabbit Polyclonal Anti-P2RX1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-P2RX1 antibody: synthetic peptide directed towards the middle region of human P2RX1. Synthetic peptide located within the following region: VVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVENG

Rabbit Polyclonal Anti-P2RX2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-P2RX2 antibody: synthetic peptide directed towards the middle region of human P2RX2. Synthetic peptide located within the following region: LIKNSIHYPKFHFSKGNIADRTDGYLKRCTFHEASDLYCPIFKLGFIVEK

P2X3 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human, Monkey
Conjugation Unconjugated
Immunogen P2RX3 / P2X3 antibody was raised against synthetic 15 amino acid peptide from C-terminal cytoplasmic domain of human P2RX3 / P2X3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Bat, Rabbit, Opossum (93%); Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse (87%).

P2X7 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Human, Monkey, Gibbon
Immunogen P2RX7 / P2X7 antibody was raised against synthetic 16 amino acid peptide from internal region of human P2RX7 / P2X7. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Marmoset, Pig (88%); Mouse, Horse (81%).

Rabbit Polyclonal Anti-P2RX3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human P2RX3

Rabbit Polyclonal Anti-P2RX2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human P2RX2