Antibodies

Jump to Filters
View as table Download
GRIK5 Rabbit Polyclonal Antibody
TA306500

USD 430.00

In Stock

Rabbit Polyclonal Grik5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Grik5 antibody was raised against a 17 amino acid peptide near the carboxy terminus of the human Grik5.
GRIK5 Rabbit Polyclonal Antibody
TA331454

USD 375.00

5 Days

Rabbit polyclonal Anti-GRIK5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GRIK5 antibody: synthetic peptide directed towards the middle region of human GRIK5. Synthetic peptide located within the following region: EDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM