Antibodies

Jump to Filters
View as table Download
GJA1 Rabbit Polyclonal Antibody
TA311737

USD 345.00

4 Weeks

Rabbit polyclonal Connexin 43 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Connexin 43.
Modifications Phospho-specific
GJA1 Rabbit Polyclonal Antibody
TA325991

USD 345.00

4 Weeks

Rabbit Polyclonal Connexin 43 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human Connexin 43.
GJD2 Rabbit Polyclonal Antibody
TA341671

USD 375.00

5 Days

Rabbit Polyclonal Anti-GJD2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GJD2 antibody: synthetic peptide directed towards the middle region of human GJD2. Synthetic peptide located within the following region: ELNHLGWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNFGRTQSSDSAY
GJA1 Rabbit Polyclonal Antibody
TA341124

USD 425.00

5 Days

Rabbit Polyclonal Anti-GJA1 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen GJA1 / CX43 / Connexin 43 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GJA1 / Connexin 43. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Hamster, Elephant, Panda, Rabbit, Pig, Opossum, Guinea pig (100%); Bat, Horse, Chicken, Lizard, Xenopus (94%); Trout, Salmon (88%); Zebrafish, Sea anemone, Nematode (81%).
GJD2 Rabbit Polyclonal Antibody
TA322251

USD 345.00

In Stock

Anti-GJD2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 157-175 amino acids of Human gap junction protein, delta 2, 36kDa