Antibodies

Jump to Filters
View as table Download
Presenilin 1 (PSEN1) Rabbit Polyclonal Antibody
TA306424

USD 430.00

In Stock

Rabbit Polyclonal Presenilin1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Presenilin1 antibody was raised against a 23 amino acid peptide from near the carboxy terminus of human presenilin1.
ADAM17 Mouse Monoclonal Antibody [Clone ID: 1F6]
AM20948PU-N

USD 480.00

2 Weeks

ADAM17 mouse monoclonal antibody, clone 1F6

Applications ELISA, IF, IHC, PLA, WB
Reactivities Human
Presenilin 1 (PSEN1) Rabbit Polyclonal Antibody
TA313388

USD 345.00

In Stock

Rabbit polyclonal Presenilin 1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human presenilin 1.
Presenilin 2 (PSEN2) Rabbit Polyclonal Antibody
TA335237

USD 375.00

5 Days

Rabbit Polyclonal Anti-PSEN2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PSEN2 antibody: synthetic peptide directed towards the N terminal of human PSEN2. Synthetic peptide located within the following region: VVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIV
ADAM17 Rabbit Polyclonal Antibody
TA321563

USD 345.00

In Stock

Anti-ADAM17 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
Presenilin 1 (PSEN1) Rabbit Polyclonal Antibody
TA357492

USD 360.00

5 Days

PSEN1 Antibody - middle region

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PSEN1