Antibodies

Jump to Filters
View as table Download
TRIB1 Rabbit Polyclonal Antibody
TA340200

USD 375.00

5 Days

Rabbit Polyclonal Anti-TRIB1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIB1 antibody: synthetic peptide directed towards the middle region of human TRIB1. Synthetic peptide located within the following region: TEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKA
TRIB1 Mouse Monoclonal Antibody [Clone ID: OTI8C8]
CF805274

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TRIB1 mouse monoclonal antibody, clone OTI8C8 (formerly 8C8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
TRIB1 Rabbit Polyclonal Antibody
TA351856

USD 345.00

In Stock

Rabbit Polyclonal Anti-TRIB1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human TRIB1
TRIB1 Mouse Monoclonal Antibody [Clone ID: OTI8C8]
TA805274

USD 379.00

In Stock

TRIB1 mouse monoclonal antibody, clone OTI8C8 (formerly 8C8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
TRIB1 Mouse Monoclonal Antibody [Clone ID: OTI8C8]
TA805274S

USD 159.00

In Stock

TRIB1 mouse monoclonal antibody, clone OTI8C8 (formerly 8C8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated