Antibodies

View as table Download

Rabbit Polyclonal Anti-NUCB2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human NUCB2

Rabbit Polyclonal Nucleobindin-2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Nucleobindin-2 antibody was raised against a 16 amino acid peptide near the center of human Nucleobindin-2 .

Rabbit Polyclonal Anti-NUCB2 Antibody

Applications IHC, WB
Reactivities Canine, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NUCB2 antibody: synthetic peptide directed towards the middle region of human NUCB2. Synthetic peptide located within the following region: MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE