Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 149 results

Page 1 of 3

(reset)

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: BP53-12]

TA327920

USD 235.00

5 Days

Mouse Monoclonal anti-P53 Antibody

Applications	IHC, WB
Reactivities	Human, non-human primates
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

p53 (TP53) (Wild type + Mutant) (20-31) Mouse Monoclonal Antibody [Clone ID: Bp53-11]

AM09102PU-N

USD 300.00

2 Weeks

p53 (TP53) (Wild type + Mutant) (20-31) mouse monoclonal antibody, clone Bp53-11, Aff - Purified

Applications	ELISA, IF, IHC, IP, WB
Reactivities	Human

p53 (TP53) Rabbit Polyclonal Antibody

TA327567

USD 345.00

3 Weeks

Rabbit anti-TP53 Polyclonal Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human TP53

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: B-P3]

AM31197AF-N

USD 470.00

2 Weeks

p53 (TP53) mouse monoclonal antibody, clone B-P3, Azide Free

Applications	FC, IHC, IP, WB
Reactivities	Human

p53 (TP53) Rabbit Polyclonal Antibody

TA326087

USD 345.00

In Stock

Rabbit polyclonal p53 (Ab-15) antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized non-phosphopeptide derived from human p53 around the phosphorylation site of Serine 15.

1 / 2

2 / 2

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA326166

USD 345.00

4 Weeks

Rabbit polyclonal p53 (Phospho-Ser15) antibody

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of Serine 15 (P-L-SP-Q-E).
Modifications	Phospho-specific

1 / 2

2 / 2

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: IMD-53]

AM20653PU-N

USD 405.00

2 Weeks

p53 (TP53) mouse monoclonal antibody, clone IMD-53, Purified

Applications	IF, IHC, WB
Reactivities	Human

1 / 2

2 / 2

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

AP20261PU-N

USD 370.00

2 Weeks

p53 (TP53) rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat

1 / 2

2 / 2

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

AP21082PU-N

USD 407.00

2 Weeks

p53 (TP53) rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

AP21106PU-N

USD 370.00

2 Weeks

p53 (TP53) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	Synthetic peptide, corresponding to amino acids 341-390 of Human p53.

1 / 2

2 / 2

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA302001

USD 450.00

5 Days

Rabbit Polyclonal Antibody against TP53 (T55)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This p53 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-62 amino acids from human p53.

1 / 3

2 / 3

3 / 3

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA324776

USD 450.00

5 Days

Rabbit polyclonal Phospho-p53(T18) Antibody

Applications	Dot, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T18 of human p53.
Modifications	Phospho-specific

1 / 3

2 / 3

3 / 3

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA324825

USD 450.00

5 Days

Rabbit polyclonal p53 Antibody (S315)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This p53 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 293-322 amino acids from human p53.

1 / 3

2 / 3

3 / 3

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA326158

USD 345.00

In Stock

Rabbit polyclonal p53 (Phospho-Thr387) antibody

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of threonine 387 (F-K-TP-E-G).
Modifications	Phospho-specific

p53 (TP53) Rabbit Polyclonal Antibody

TA329140

USD 375.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications	Assay, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA329141

USD 375.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications	Assay, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

p53 (TP53) pSer20 Rabbit Polyclonal Antibody

AP20897PU-N

USD 370.00

2 Weeks

p53 (TP53) pSer20 rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse

1 / 2

2 / 2

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

AP20988PU-N

USD 370.00

2 Weeks

p53 (TP53) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse

1 / 2

2 / 2

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

AP21105PU-N

USD 370.00

2 Weeks

p53 (TP53) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse, Rat

1 / 2

2 / 2

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA324774

USD 450.00

5 Days

Rabbit polyclonal Phospho-p53(S20) Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S20 of human p53.
Modifications	Phospho-specific

1 / 2

2 / 2

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA325949

USD 345.00

4 Weeks

Rabbit Polyclonal p53 Antibody

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against a synthesized A synthesized peptide derived from human p53.

1 / 2

2 / 2

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: Pab 1801]

TA326387

USD 345.00

5 Days

Mouse monoclonal p53 Antibody

Applications	IHC, WB
Reactivities	Human

1 / 2

2 / 2

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA354205

USD 300.00

5 Days

Rabbit anti p53 Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide corresponding to the N-terminus of human p53 protein

1 / 2

2 / 2

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA354509

USD 325.00

5 Days

Rabbit anti P53(pS15) Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide corresponding to the epitope –PLSQE- at a phosphorylation site at serine 15 of human p53 protein

1 / 2

2 / 2

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA354572

USD 355.00

5 Days

Rabbit anti P53(pS37) Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide corresponding to the epitope –LPSPH- at a phosphorylation site at serine 37 of human p53 protein

1 / 2

2 / 2

Previous Next

p53 (TP53) pSer37 Rabbit Polyclonal Antibody

AP20898PU-N

USD 370.00

2 Weeks

p53 (TP53) pSer37 rabbit polyclonal antibody, Aff - Purified

Applications	IHC
Reactivities	Human

p53 (TP53) Rabbit Polyclonal Antibody

AP20989PU-N

USD 370.00

2 Weeks

p53 (TP53) rabbit polyclonal antibody, Aff - Purified

Applications	IHC
Reactivities	Human

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: S20]

TA354364

USD 355.00

5 Days

Mouse anti p53 Monoclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI3D5]

CF502780

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI2C4]

CF502781

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI2C4 (formerly 2C4)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI1C6]

CF502782

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI3G9]

CF502784

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI3G9 (formerly 3G9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI2F7]

CF502800

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI2F7 (formerly 2F7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI3F5]

CF502801

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI1F4]

CF502802

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI1D8]

CF502851

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI1D8 (formerly 1D8)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI5E2]

CF502870

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI5E2 (formerly 5E2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI3A6]

CF502924

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI3A6 (formerly 3A6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI1D11]

CF502987

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI1D11 (formerly 1D11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI1E1]

CF503033

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)

Applications	IHC, WB
Reactivities	Human, Monkey
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI2H6]

CF503034

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI2H6 (formerly 2H6)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI9A7]

CF802994

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI9A7 (formerly 9A7)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: DO-1]

CF804804

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone DO-1

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: DO-7]

CF804805

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone DO-7

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI5B1]

CF805353

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI5B1 (formerly 5B1)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI7A2]

CF805414

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI7A2 (formerly 7A2)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI7F3]

CF805482

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI7F3 (formerly 7F3)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI7A11]

CF805505

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI7A11 (formerly 7A11)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTIpab 240]

CF808657

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) p53 mouse monoclonal antibody,clone OTIpab 240

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated

• 

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: DO7]

TA327719

USD 535.00

5 Days

Mouse Monoclonal p53 Antibody

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated

1 - 50 of 149 results

Page 1 of 3