Antibodies

View as table Download

Rabbit anti-RPA2 Polyclonal Antibody

Applications ChIP, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RPA2

Rabbit anti-MRE11A Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human MRE11A

Rabbit anti-POLD1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human POLD1

Rabbit Polyclonal antibody to RPA70 (replication protein A1, 70kDa)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 369 and 616 of RPA70 (Uniprot ID#P27694)

Rabbit Polyclonal Anti-RAD51 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-RAD51 Antibody: synthetic peptide directed towards the N terminal of human RAD51. Synthetic peptide located within the following region: ANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILVMAERYGLS

Rabbit Polyclonal MRE11 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen MRE11 antibody was raised against a 14 amino acid peptide from near the amino terminus human MRE11.

Rabbit polyclonal Bloom Syndrome Protein (Thr99)(Phospho-specific)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Bloom Syndrome Protein around the phosphorylation site of threonine 99 (Q-E-TP-Q-R).
Modifications Phospho-specific

Rabbit Polyclonal Antibody against Mre11

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length human Mre11 protein

Rabbit polyclonal antibody to RPA 14 kDa subunit (replication protein A3, 14kDa)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 121 of RPA14 (Uniprot ID#P35244)

Rabbit polyclonal antibody to RPA 32 kDa subunit (replication protein A2, 32kDa)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 202 of RPA32 (Uniprot ID#P15927)

Rabbit polyclonal RFA2 (Thr21) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human RFA2 around the phosphorylation site of threonine 21 (G-Y-TP-Q-S).
Modifications Phospho-specific

Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI10G1 (formerly 10G1)

Applications FC, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI7C12 (formerly 7C12)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI8B3 (formerly 8B3)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI7F4 (formerly 7F4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-RAD51 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 301-312 amino acids of Human RAD51 homolog (S. cerevisiae)

Rabbit Polyclonal Anti-MRE11A Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MRE11A

Rabbit Polyclonal Anti-RPA2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit Polyclonal Anti-MRE11A Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human MRE11A

Rabbit Polyclonal Anti-RAD51 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human RAD51

RPA2 mouse monoclonal antibody, clone OTI10G1 (formerly 10G1)

Applications FC, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RPA2 mouse monoclonal antibody, clone OTI10G1 (formerly 10G1), Biotinylated

Applications FC, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

RPA2 mouse monoclonal antibody, clone OTI10G1 (formerly 10G1), HRP conjugated

Applications FC, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

RPA2 mouse monoclonal antibody, clone OTI10G1 (formerly 10G1)

Applications FC, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

RPA2 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

RPA2 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1), Biotinylated

Applications FC, IF, IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Biotin

RPA2 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1), HRP conjugated

Applications FC, IF, IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation HRP

RPA2 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

RPA2 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RPA2 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12), Biotinylated

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

RPA2 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12), HRP conjugated

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

RPA2 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

RPA2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

RPA2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), Biotinylated

Applications FC, IF, IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Biotin

RPA2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), HRP conjugated

Applications FC, IF, IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation HRP

RPA2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

RPA2 mouse monoclonal antibody, clone OTI7C12 (formerly 7C12)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

RPA2 mouse monoclonal antibody, clone OTI7C12 (formerly 7C12), Biotinylated

Applications FC, IF, IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Biotin

RPA2 mouse monoclonal antibody, clone OTI7C12 (formerly 7C12), HRP conjugated

Applications FC, IF, IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation HRP

RPA2 mouse monoclonal antibody, clone OTI7C12 (formerly 7C12)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

RPA2 mouse monoclonal antibody, clone OTI8B3 (formerly 8B3)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RPA2 mouse monoclonal antibody, clone OTI8B3 (formerly 8B3), Biotinylated

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

RPA2 mouse monoclonal antibody, clone OTI8B3 (formerly 8B3), HRP conjugated

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

RPA2 mouse monoclonal antibody, clone OTI8B3 (formerly 8B3)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Anti-RPA2 mouse monoclonal antibody, clone OTI7F4 (formerly 7F4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated