Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 25 of 25 results

(reset)

GATA3 Goat Polyclonal Antibody

TA305795

USD 375.00

2 Weeks

Goat Anti-GATA3 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence EVTADQPRWVSHH-C, from the N Terminus of the protein sequence according to NP_001002295.1; NP_002042.1.

1 / 3

2 / 3

3 / 3

Previous Next

GATA3 Rabbit Polyclonal Antibody

TA306922

USD 430.00

In Stock

Rabbit Polyclonal GATA3 Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	GATA3 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human GATA3. The immunogen is located within amino acids 340 - 390 of GATA3.

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

GATA3 Rabbit Polyclonal Antibody

TA330598

USD 310.00

5 Days

Rabbit Polyclonal Anti-GATA3 Antibody

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-GATA3 antibody: synthetic peptide directed towards the C terminal of human GATA3. Synthetic peptide located within the following region: RNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSS

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

GATA3 Rabbit Polyclonal Antibody

TA313285

USD 345.00

In Stock

Rabbit polyclonal anti-GATA3 antibody

Applications	IF, IHC
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from Internal of human GATA3.

1 / 2

2 / 2

Previous Next

GATA3 (2-14) Goat Polyclonal Antibody

AP23635PU-N

USD 440.00

2 Weeks

GATA3 (2-14) goat polyclonal antibody, Aff - Purified

Applications	ELISA, IHC, WB
Reactivities	Bovine, Bat, Canine, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Sheep
Immunogen	Synthetic peptide from the N-terminus of human GATA3 (NP_001002295.1; NP_002042.1)

1 / 3

2 / 3

3 / 3

Previous Next

GATA3 Rabbit Polyclonal Antibody

TA330597

USD 375.00

5 Days

Rabbit Polyclonal Anti-GATA3 Antibody

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-GATA3 antibody: synthetic peptide directed towards the C terminal of human GATA3. Synthetic peptide located within the following region: RNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSS

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

GATA3 Rabbit Polyclonal Antibody

TA329424

USD 375.00

5 Days

Rabbit Polyclonal anti-GATA3 antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-GATA3 antibody: synthetic peptide directed towards the N terminal of human GATA3. Synthetic peptide located within the following region: MDAAQYPLPEEVDVLFNIDGQGNHVPPYYGNSVRATVQRYPPTHHGSQVC

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

GATA3 Mouse Monoclonal Antibody [Clone ID: OTI5C11]

CF809094

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GATA3 mouse monoclonal antibody, clone OTI5C11 (formerly 5C11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

GATA3 Mouse Monoclonal Antibody [Clone ID: OTI8H4]

CF809095

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GATA3 mouse monoclonal antibody, clone OTI8H4 (formerly 8H4)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

GATA3 Mouse Monoclonal Antibody [Clone ID: OTI10G7]

CF809219

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GATA3 mouse monoclonal antibody, clone OTI10G7

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

GATA3 Mouse Monoclonal Antibody [Clone ID: OTI5C11]

TA809094

USD 379.00

In Stock

GATA3 mouse monoclonal antibody, clone OTI5C11 (formerly 5C11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

GATA3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5C11]

TA809094AM

USD 420.00

4 Weeks

GATA3 mouse monoclonal antibody, clone OTI5C11 (formerly 5C11), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

GATA3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5C11]

TA809094BM

USD 420.00

4 Weeks

GATA3 mouse monoclonal antibody, clone OTI5C11 (formerly 5C11), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

GATA3 Mouse Monoclonal Antibody [Clone ID: OTI5C11]

TA809094S

USD 159.00

2 Days

GATA3 mouse monoclonal antibody, clone OTI5C11 (formerly 5C11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

GATA3 Mouse Monoclonal Antibody [Clone ID: OTI8H4]

TA809095

USD 379.00

In Stock

GATA3 mouse monoclonal antibody, clone OTI8H4 (formerly 8H4)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

GATA3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8H4]

TA809095AM

USD 420.00

4 Weeks

GATA3 mouse monoclonal antibody, clone OTI8H4 (formerly 8H4), Biotinylated

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

GATA3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8H4]

TA809095BM

USD 420.00

4 Weeks

GATA3 mouse monoclonal antibody, clone OTI8H4 (formerly 8H4), HRP conjugated

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

GATA3 Mouse Monoclonal Antibody [Clone ID: OTI8H4]

TA809095S

USD 159.00

In Stock

GATA3 mouse monoclonal antibody, clone OTI8H4 (formerly 8H4)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

GATA3 Mouse Monoclonal Antibody [Clone ID: OTI10G7]

TA809219

USD 379.00

In Stock

GATA3 mouse monoclonal antibody, clone OTI10G7

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

GATA3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10G7]

TA809219AM

USD 420.00

4 Weeks

GATA3 mouse monoclonal antibody, clone OTI10G7, Biotinylated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

GATA3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10G7]

TA809219BM

USD 420.00

4 Weeks

GATA3 mouse monoclonal antibody, clone OTI10G7, HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

GATA3 Mouse Monoclonal Antibody [Clone ID: OTI10G7]

TA809219S

USD 159.00

2 Days

GATA3 mouse monoclonal antibody, clone OTI10G7

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

GATA3 Mouse Monoclonal Antibody [Clone ID: UMAB218]

UM800110

USD 468.00

In Stock

GATA3 mouse monoclonal antibody,clone UMAB218

Applications	10k-ChIP, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

GATA3 Mouse Monoclonal Antibody [Clone ID: UMAB218]

UM800110CF

USD 528.00

4 Weeks

Carrier-free (BSA/glycerol-free) GATA3 mouse monoclonal antibody,clone UMAB218

Applications	10k-ChIP, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

GATA3 Mouse Monoclonal Antibody [Clone ID: UMAB218]

UM870110

USD 180.00

In Stock

GATA3 mouse monoclonal antibody,clone UMAB218

Applications	10k-ChIP, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

1 - 25 of 25 results