Antibodies

Jump to Filters
View as table Download
TCF7L1 Rabbit Polyclonal Antibody
TA329110

USD 375.00

5 Days

Rabbit Polyclonal anti-TCF7L1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TCF7L1 antibody: synthetic peptide directed towards the N terminal of human TCF7L1. Synthetic peptide located within the following region: NDELIPFQDEGGEEQEPSSDSASAQRDLDEVKSSLVNESENQSSSSDSEA
TCF7 Rabbit Polyclonal Antibody
TA338240

USD 375.00

5 Days

Rabbit Polyclonal Anti-TCF7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TCF7 antibody: synthetic peptide directed towards the middle region of human TCF7. Synthetic peptide located within the following region: PAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFM
p53 (TP53) Rabbit Polyclonal Antibody
TA354205

USD 300.00

5 Days

Rabbit anti p53 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the N-terminus of human p53 protein
c Fos (FOS) Rabbit Polyclonal Antibody
TA354319

USD 355.00

5 Days

Rabbit anti c-fos Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to N-term of c-Fos protein. This sequence is identical in human, mouse, rat abd bovine.
p53 (TP53) Rabbit Polyclonal Antibody
TA354509

USD 325.00

5 Days

Rabbit anti P53(pS15) Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the epitope –PLSQE- at a phosphorylation site at serine 15 of human p53 protein
p53 (TP53) Rabbit Polyclonal Antibody
TA354572

USD 355.00

5 Days

Rabbit anti P53(pS37) Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the epitope –LPSPH- at a phosphorylation site at serine 37 of human p53 protein
SMAD4 Rabbit Polyclonal Antibody
TA321708

USD 345.00

In Stock

Anti-SMAD4 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 14-227 amino acids of Human Mothers against decapentaplegic homolog 4
TGF beta 1 (TGFB1) Rabbit Polyclonal Antibody
TA323601

USD 345.00

4 Weeks

Anti-TGFB1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 30-278 amino acids of human transforming growth factor, beta 1
SMAD3 Rabbit Polyclonal Antibody
TA350976

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-SMAD3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SMAD3