Antibodies

Jump to Filters
View as table Download
OLIG2 Rabbit Polyclonal Antibody
TA349037

USD 484.00

In Stock

Rabbit Polyclonal Anti-OLIG2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen OLIG2 antibody was raised against a 15 amino acid peptide near the amino terminus of human OLIG2.
OLIG2 Rabbit Polyclonal Antibody
TA590593

USD 409.00

In Stock

Rabbit Polyclonal OLIG2 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody was made against a protein fragment from the N Terminus Region
OLIG2 Rabbit Polyclonal Antibody
TA329297

USD 375.00

5 Days

Rabbit Polyclonal anti-OLIG2 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-OLIG2 antibody: synthetic peptide directed towards the N terminal of human OLIG2. Synthetic peptide located within the following region: MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPE
OLIG2 Rabbit Polyclonal Antibody
TA331141

USD 375.00

5 Days

Rabbit Polyclonal Anti-OLIG2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-OLIG2 antibody: synthetic peptide directed towards the N terminal of human OLIG2. Synthetic peptide located within the following region: MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPE
OLIG2 Rabbit Polyclonal Antibody
TA331142

USD 375.00

5 Days

Rabbit Polyclonal Anti-OLIG2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OLIG2 antibody is: synthetic peptide directed towards the C-terminal region of Human OLIG2. Synthetic peptide located within the following region: AAVSSASLPGSGLPSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSGASGGF