Antibodies

View as table Download

Rabbit Polyclonal Anti-ASH2L Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ASH2L Antibody: synthetic peptide directed towards the middle region of human ASH2L. Synthetic peptide located within the following region: AAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFN

Rabbit Polyclonal Anti-ASH2L Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ASH2L Antibody: synthetic peptide directed towards the N terminal of human ASH2L. Synthetic peptide located within the following region: EPSSGEAEGGEANLVDVSGGLETESSNGKDTLEGAGDTSEVMDTQAGSVD

Carrier-free (BSA/glycerol-free) ASH2L mouse monoclonal antibody,clone OTI10D8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ASH2L mouse monoclonal antibody,clone OTI2H3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ASH2L mouse monoclonal antibody,clone OTI7D11

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-ASH2L Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ASH2L

ASH2L mouse monoclonal antibody,clone OTI10D8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASH2L mouse monoclonal antibody,clone OTI2H3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASH2L mouse monoclonal antibody,clone OTI2H3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ASH2L mouse monoclonal antibody,clone OTI7D11

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASH2L mouse monoclonal antibody,clone OTI7D11

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".