Antibodies

View as table Download

Rabbit Polyclonal antibody to VAPA (VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 29 and 122 of VAPA (Uniprot ID#Q9P0L0)

Rabbit Polyclonal Anti-CLDN11 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN11 antibody: synthetic peptide directed towards the C terminal of human CLDN11. Synthetic peptide located within the following region: VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH

Rabbit Polyclonal antibody to JAM-B (junctional adhesion molecule 2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 294 of JAM-B (Uniprot ID#P57087)

Rabbit polyclonal anti-CLDN6 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CLDN6.

F11R Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human F11R

Rabbit polyclonal anti-Claudin 3 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Claudin 3.

Rabbit polyclonal anti-Claudin 5 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human CLDN5.

Rabbit polyclonal Claudin 7 (Ab-210) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen he antiserum was produced against synthesized non-phosphopeptide derived from human Claudin 7 around the phosphorylation site of tyrosine 210 (S-K-E-YP-V).

Rabbit polyclonal anti-Claudin 7 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Claudin 7.

Rabbit polyclonal Claudin 5 (Tyr217) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Claudin 5 around the phosphorylation site of tyrosine 217 (K-N-YP-V).
Modifications Phospho-specific

Rabbit polyclonal anti-Claudin 1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Claudin 1.

Rabbit polyclonal anti-Claudin 4 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Claudin 4.

Rabbit Polyclonal Anti-CLDN17 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN17 antibody: synthetic peptide directed towards the middle region of human CLDN17. Synthetic peptide located within the following region: KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA

Rabbit Polyclonal Anti-CLDN8 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN8 antibody: synthetic peptide directed towards the C terminal of human CLDN8. Synthetic peptide located within the following region: IVGGALFCCVFCCNEKSSSYRYSIPSHRTTQKSYHTGKKSPSVYSRSQYV

Rabbit Polyclonal Anti-CLDN1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN1 antibody: synthetic peptide directed towards the C terminal of human CLDN1. Synthetic peptide located within the following region: GQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV

Rabbit anti Claudin 10 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide from C-terminus of human claudin 10 protein.

Rabbit anti Claudin 1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide from C-terminus of human claudin 1 protein.

Anti-CLDN4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 193-209 amino acids of Human claudin 4

Anti-CLDN4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 193-209 amino acids of Human claudin 4

Anti-CLDN10 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 215-228 amino acids of Human claudin 10

Anti-CLDN10 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 215-228 amino acids of Human claudin 11

Anti-CLDN1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 196-209 amino acids of Human claudin 1

Anti-CLDN1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 196-209 amino acids of Human claudin 1

Anti-CLDN19 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 186-200 amino acids of Human Claudin 19

Anti-CLDN19 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 186-200 amino acids of Human Claudin 19

Anti-CLDN3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 207-220 amino acids of Human claudin 3

Anti-CLDN3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 207-220 amino acids of Human claudin 4

Anti-CLDN7 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 199-212 amino acids of Human claudin 7

Anti-CLDN7 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 199-212 amino acids of Human claudin 7

Anti-CLDN5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 202-215 amino acids of Human claudin 5

Anti-CLDN5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 202-215 amino acids of Human claudin 5

Rabbit Polyclonal Anti-F11R Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human F11R

Rabbit Polyclonal Anti-VAPA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit Polyclonal Anti-CLDN2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLDN2

Rabbit Polyclonal Anti-CLDN8 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLDN8

Rabbit Polyclonal Anti-CLDN11 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLDN11