Rabbit Polyclonal antibody to VAPA (VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 29 and 122 of VAPA (Uniprot ID#Q9P0L0) |
Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014) |
Rabbit polyclonal antibody to MC1R (melanocortin 1 receptor (alpha melanocyte stimulating hormone receptor))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 253 and 317 of MC1 Receptor (Uniprot ID#Q01726) |
Rabbit Polyclonal Antibody against LINGO1 (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This LINGO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-92 amino acids from the N-terminal region of human LINGO1. |
Rabbit Polyclonal antibody to RANKL (tumor necrosis factor (ligand) superfamily, member 11)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 253 and 317 of RANKL (Uniprot ID#O14788) |
Rabbit Polyclonal antibody to MGAT3 (mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 260 and 525 of MGAT3 (Uniprot ID#Q09327) |
HRH1 / H1 Receptor Goat Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Chimpanzee, Gorilla, Human, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | HRH1 / Histamine H1 Receptor antibody was raised against synthetic peptide CNENFKKTFKRILH from the C-terminus of human HRH1 / Histamine H1 Receptor (NP_000852.1; NP_001091681.1; NP_001091682.1; NP_001091683.1). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Bat, Platypus (100%); Monkey, Mouse, Rat, Dog, Bovine, Hamster, Elephant, Panda, Rabbit, Horse, Pig, Turkey, Chicken (93%); Marmoset, Guinea pig, Xenopus (86%). |
Rabbit polyclonal CNIH2 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CNIH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 31-59 amino acids from the N-terminal region of human CNIH2. |
ILEI / FAM3C Rabbit Polyclonal (aa40-80) Antibody
| Applications | IHC |
| Reactivities | Bovine, Chimpanzee, Chicken, Human, Monkey, Mouse, Opossum, Rat, Dog, Pufferfish |
| Conjugation | Unconjugated |
| Immunogen | ILEI / FAM3C antibody was raised against synthetic peptide from human FAM3C. |
Rabbit Polyclonal Calnexin Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Avian, Drosophila |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the canine Calnexin protein (within residues 25-100). [Swiss-Prot P24643] |
GLG1 / MG160 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Gorilla, Dog, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | GLG1 / MG160 antibody was raised against synthetic 18 amino acid peptide from internal region of human GLG1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bat, Bovine, Hamster, Elephant, Panda, Horse, Rabbit, Opossum, Turkey, Chicken, Xenopus, Zebrafish (100%); Stickleback (89%). |
GluT-1 / GLAST Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | SLC1A3 / GluT-1 / GLAST antibody was raised against synthetic 19 amino acid peptide from cytoplasmic domain of human SLC1A3 / GLAST. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Bovine, Horse, Rabbit, Pig (100%); Panda, Dog, Opossum, Guinea pig, Turkey, Chicken (95%); Xenopus (84%). |
Rabbit polyclonal ITGA6 Antibody (isoform 2 S1064)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ITGA6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1043-1072 amino acids from human ITGA6. |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Quail, Rabbit, Sheep, Drosophila, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Dog calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues. |
KCNMA1 / BK Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Dog, Pig |
| Conjugation | Unconjugated |
| Immunogen | KCNMA1 / BK antibody was raised against synthetic 15 amino acid peptide from internal region of human KCNMA1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Hamster, Bovine, Dog, Rabbit, Pig, Turkey, Chicken, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%). |
PGES / PTGES Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Chicken, Dog, Gorilla, Horse, Human, Monkey, Pig, Rabbit, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | PGES / PTGES antibody was raised against synthetic 14 amino acid peptide from near N-terminus of human PTGES. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Rat, Bovine, Dog, Elephant, Panda, Rabbit, Horse, Pig, Opossum, Turkey, Chicken, Platypus, Pufferfish, Zebrafish, Stickleback (100%); Mouse, Xenopus, Pike (93%). |
TM9SF3 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Chimpanzee, Chicken, Guinea Pig, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Xenopus, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | TM9SF3 antibody was raised against synthetic 15 amino acid peptide from internal region of human TM9SF3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Panda, Bovine, Dog, Horse, Rabbit, Pig, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Xenopus (100%); Lizard, Stickleback, Medaka (93%); Bat, Salmon, Zebrafish, Eye worm, Tick (87%); Pufferfish, Drosophila, Water flea, Nematode (80%). |
TM9SF3 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | TM9SF3 antibody was raised against synthetic 17 amino acid peptide from internal region of human TM9SF3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Elephant, Panda, Horse, Rabbit, Pig, Turkey, Chicken, Platypus, Xenopus, Pufferfish, Zebrafish (100%); Salmon, Stickleback (94%); Opossum, Seq squirt (82%). |
TMEM33 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Monkey, Pig |
| Conjugation | Unconjugated |
| Immunogen | TMEM33 antibody was raised against synthetic 18 amino acid peptide from internal region of human TMEM33. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Dog, Bat, Elephant, Panda, Horse, Pig, Opossum, Platypus (100%); Mouse, Rat, Hamster, Rabbit, Turkey, Chicken, Lizard, Xenopus, Zebrafish (94%); Catfish, Salmon, Stickleback, Sea anemone (89%); Drosophila (83%). |
WNT7A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chimpanzee, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Xenopus, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | WNT7A antibody was raised against synthetic 12 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus (100%); Seabass (92%); Stickleback, Pufferfish, Zebrafish (83%). |
Rabbit Polyclonal Anti-SHH Antibody
| Applications | IHC, WB |
| Reactivities | Chicken, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SHH antibody: synthetic peptide directed towards the N terminal of human SHH. Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT |
Rabbit Polyclonal ATG9A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the C-terminus of human ATG9A (between residues 750-839). [Swiss-Prot# Q7Z3C6]. |
Rabbit Polyclonal Tmp21/p23 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Primate, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal sequence of the human TMP21 protein (within residues 100-200). [Swiss-Prot# P49755] |
Rabbit Polyclonal Anti-SLC31A1 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | SLC31A1 / CTR1 antibody was raised against synthetic 16 amino acid peptide from internal region of human CTR1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Dog, Elephant, Panda, Rabbit, Opossum, Platypus (100%); Mouse, Rat, Bovine, Hamster, Horse, Pig, Turkey, Chicken (94%); Xenopus (88%); Pufferfish (81%). |
GLG1 / MG160 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Chimpanzee, Chicken, Dog, Xenopus, Guinea pig, Gorilla, Horse, Human, Monkey, Mouse, Orang-Utan, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | GLG1 / MG160 antibody was raised against synthetic 19 amino acid peptide from internal region of human GLG1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Lizard, Xenopus (100%); Hamster (95%); Stickleback, Medaka, Pufferfish, Zebrafish (84%). |
GPR39 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Horse, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | GPR39 antibody was raised against synthetic 16 amino acid peptide from 3rd extracellular domain of human GPR39. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Mouse, Rat, Horse, Rabbit (100%); Marmoset, Bovine, Panda, Turkey, Chicken (94%); Pig, Opossum (88%); Dog (81%). |
KCNMA1 / BK Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Pig, Horse |
| Conjugation | Unconjugated |
| Immunogen | KCNMA1 / BK antibody was raised against synthetic 15 amino acid peptide from internal region of human KCNMA1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Hamster, Bovine, Horse, Rabbit, Pig, Turkey, Chicken, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%). |
Latrophilin-3 / LPHN3 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bat, Chicken, Gorilla, Horse, Human, Monkey, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | LPHN3 / Latrophilin-3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human LPHN3. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Mouse, Rat, Bat, Elephant, Panda, Horse, Rabbit, Opossum, Turkey, Chicken, Lizard (100%); Bovine, Platypus (95%); Gibbon (89%). |
KIAA0152 / MLEC Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | KIAA0152 / MLEC antibody was raised against synthetic 18 amino acid peptide from internal region of human MLEC. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Turkey, Chicken, Platypus, Xenopus, Zebrafish (100%); Stickleback (94%). |
NPSR1 / NPSR Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Hamster, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | NPSR1 / NPSR / GPR154 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human NPSR1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster (100%); Elephant, Panda, Bovine, Bat, Pig, Turkey, Chicken (94%); Dog, Opossum, Lizard (89%); Horse, Platypus (83%). |
SURF4 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Chicken, Xenopus, Gorilla, Human, Mouse, Orang-Utan, Rat |
| Conjugation | Unconjugated |
| Immunogen | SURF4 antibody was raised against synthetic 18 amino acid peptide from N-Terminus of human SURF4. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Mouse, Rat, Bovine, Turkey, Chicken, Xenopus, Salmon (100%); Marmoset, Hamster, Elephant, Panda, Dog, Bat, Opossum, Platypus, Pufferfish, Zebrafish (94%); Stickleback (89%). |
TRPV4 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rat |
| Conjugation | Unconjugated |
| Immunogen | TRPV4 antibody was raised against synthetic 20 amino acid peptide from internal region of human TRPV4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Panda, Bovine, Dog, Horse, Pig (100%); Elephant, Rabbit (95%); Turkey, Chicken, Platypus (90%); Xenopus (85%); Stickleback, Zebrafish (80%). |
WNT11 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | WNT11 antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT11. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Rabbit, Pig, Turkey, Chicken, Platypus (100%); Opossum, Stickleback (87%); Xenopus, Zebrafish (80%). |
Rabbit Polyclonal Anti-GRM8 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GRM8 / MGLUR8 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human GRM8 / MGLUR8. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Baboon, Monkey, Galago, Marmoset, Mouse, Rat, Shrew, Bat, Horse, Armadillo (100%); Opossum, Chicken (95%); Platypus, Xenopus (89%); Stickleback (84%). |
Rabbit Polyclonal Anti-GPR124 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GPR124 / TEM5 antibody was raised against synthetic 17 amino acid peptide from N-terminal extracellular domain of human GPR124. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Dog, Bat, Elephant, Panda, Horse, Rabbit, Pig, Opossum (100%); Mouse, Rat, Hamster, Turkey, Chicken, Xenopus (94%); Monkey, Bovine, Platypus, Lizard (82%). |
Rabbit Polyclonal Anti-CXCR4 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against synthetic 17 amino acid peptide from C-terminus of human CXCR4. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Baboon, Monkey, Marmoset, Tamarin, Mouse, Rat, Bat, Bovine, Dog, Cat, Hamster, Panda, Rabbit, Horse, Pig, Opossum, Lizard (100%); Elephant, Turkey, Chicken (94%). |
Rabbit Polyclonal Anti-EPHB2 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | EPHB2 / EPH Receptor B2 antibody was raised against synthetic 15 amino acid peptide from internal region of human EPHB2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Mouse, Rat, Panda, Rabbit, Opossum, Zebrafish (100%); Hamster, Elephant, Bovine, Pig, Turkey, Chicken, Pufferfish (93%); Xenopus, Seabass (87%); Stickleback (80%). |
Rabbit Polyclonal Anti-GJA1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GJA1 / CX43 / Connexin 43 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GJA1 / Connexin 43. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Hamster, Elephant, Panda, Rabbit, Pig, Opossum, Guinea pig (100%); Bat, Horse, Chicken, Lizard, Xenopus (94%); Trout, Salmon (88%); Zebrafish, Sea anemone, Nematode (81%). |
Rabbit Polyclonal Anti-ITGA2 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ITGA2 / CD49b antibody was raised against synthetic 16 amino acid peptide from extracellular domain of human ITGA2 / CD49b. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Dog, Panda, Pig (100%); Bovine, Elephant, Horse, Chicken, Lizard (94%); Opossum, Turkey (88%); Bat, Hamster, Stickleback (81%). |
Rabbit Polyclonal Anti-LINGO1 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | LINGO1 antibody was raised against synthetic 17 amino acid peptide from internal region of human LINGO1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Marmoset, Mouse, Rat, Elephant, Panda, Bovine, Dog, Horse, Rabbit, Pig, Stickleback, Zebrafish (100%); Bat, Opossum, Turkey, Chicken, Pufferfish (94%); Xenopus (82%). |
Rabbit Polyclonal Anti-WNT1 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | WNT1 antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig (100%); Chicken (94%); Lizard (88%); Zebrafish (81%). |
Germany
Japan
United Kingdom
China
