Antibodies

Jump to Filters
View as table Download
14 3 3 eta (YWHAH) Rabbit Polyclonal Antibody
AP20467PU-N

USD 407.00

2 Weeks

14 3 3 eta (YWHAH) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 50-100 of Human 14-3-3 η.
14 3 3 eta (YWHAH) Rabbit Polyclonal Antibody
TA330344

USD 375.00

5 Days

Rabbit Polyclonal Anti-YWHAH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-YWHAH antibody: synthetic peptide directed towards the N terminal of human YWHAH. Synthetic peptide located within the following region: ADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKV