Antibodies

Jump to Filters
View as table Download
EEA1 Rabbit Polyclonal Antibody
TA344446

USD 475.00

5 Days

Rabbit Polyclonal Anti-EEA1 Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EEA1 antibody: synthetic peptide directed towards the middle region of human EEA1. Synthetic peptide located within the following region: QEKRNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEA
EEA1 Rabbit Polyclonal Antibody
TA329101

USD 375.00

5 Days

Rabbit Polyclonal anti-EEA1 antibody

Applications IHC, IP, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EEA1 antibody: synthetic peptide directed towards the N terminal of human EEA1. Synthetic peptide located within the following region: LTENLLKKEQDYTKLEEKHNEESVSKKNIQATLHQKDLDCQQLQSRLSAS