EEA1 Rabbit Polyclonal Antibody

CAT#: TA344446

Rabbit Polyclonal Anti-EEA1 Antibody - middle region

Product Images

WB Suggested Anti-EEA1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: 721_B cell lysateEEA1 is supported by BioGPS gene expression data to be expressed in 721_B

• 

  Rabbit Anti-EEA1 Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver; Observed Staining: Cytoplasm in hepatocytes, moderate signal, moderate tissue distribution; Primary Antibody Concentration: 1:100; Secondary Antibody: Donkey anti-Rabbi

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EEA1 antibody: synthetic peptide directed towards the middle region of human EEA1. Synthetic peptide located within the following region: QEKRNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 162 kDa
• Gene Name: early endosome antigen 1
• Database Link:
  NP_003557
  Entrez Gene 8411 Human
  UniProt ID Q15075
• Background: EEA1 is involved in neuronal synaptic vesicle function and axonal transport and growth. EEA1 may undergo calcium-dependent conformational changes that are required for binding to SNAP-25.
• Synonyms: MST105; MSTP105; ZFYVE2
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 90%; Dog: 79%; Horse: 79%; Bovine: 79%; Rabbit: 79%

Reference Data

• Protein Pathways: Endocytosis