Antibodies

Jump to Filters
View as table Download
GPAA1 (N-term) Rabbit Polyclonal Antibody
AP51898PU-N

USD 450.00

2 Weeks

GPAA1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 49-77 amino acids from the N-terminal region of human GPAA1
PIGA (C-term) Rabbit Polyclonal Antibody
AP53294PU-N

USD 450.00

2 Weeks

PIGA (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region of human PIGA.
PIGX (N-term) Rabbit Polyclonal Antibody
AP53302PU-N

USD 450.00

2 Weeks

PIGX (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 74-103) of human PIGX.
PIGY Rabbit Polyclonal Antibody
TA306691

USD 430.00

5 Days

Rabbit Polyclonal PIG-Y Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen PIG-Y antibody was raised against a 16 amino acid peptide near the carboxy terminus of human PIG-Y.
PIGY Rabbit Polyclonal Antibody
TA306696

USD 430.00

5 Days

Rabbit Polyclonal PIG-Y Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen PIG-Y antibody was raised against a 16 amino acid peptide near the center of human PIG-Y.
PIGH Rabbit Polyclonal Antibody
TA314340

USD 345.00

In Stock

Rabbit polyclonal anti-PIGH antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human PIGH.
GPAA1 Rabbit Polyclonal Antibody
TA339374

USD 375.00

5 Days

Rabbit Polyclonal Anti-GPAA1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPAA1 antibody: synthetic peptide directed towards the C terminal of human GPAA1. Synthetic peptide located within the following region: LGSLFLWRELQEAPLSLAEGWQLFLAALAQGVLEHHTYGALLFPLLSLGL
PIGV Rabbit Polyclonal Antibody
TA342041

USD 310.00

5 Days

Rabbit Polyclonal Anti-PIGV Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIGV antibody: synthetic peptide directed towards the N terminal of human PIGV. Synthetic peptide located within the following region: FVDQLVEGLLGGLSHWDAEHFLFIAEHGYLYEHNFAFFPGFPLALLVGTE
PIGY Rabbit Polyclonal Antibody
TA315949

USD 345.00

4 Weeks

Rabbit polyclonal anti-PIGY antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PIGY