Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 56 results

Page 1 of 2

(reset)

ADH5 Rabbit Polyclonal Antibody

TA327239

USD 275.00

3 Weeks

Rabbit anti-ADH5 Polyclonal Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human ADH5

1 / 3

2 / 3

3 / 3

Previous Next

SHMT2 Rabbit Polyclonal Antibody

TA327002

USD 380.00

3 Weeks

Rabbit anti-SHMT2 Polyclonal Antibody

Applications	ICC/IF, IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human SHMT2

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Peroxiredoxin 6 (PRDX6) Rabbit Polyclonal Antibody

TA327232

USD 275.00

3 Weeks

Rabbit anti-PRDX6 Polyclonal Antibody

Applications	ICC/IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human PRDX6

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Peroxiredoxin 6 (PRDX6) Rabbit Polyclonal Antibody

TA346592

USD 475.00

5 Days

Rabbit Polyclonal Anti-PRDX6 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-PRDX6 antibody: synthetic peptide directed towards the C terminal of human PRDX6. Synthetic peptide located within the following region: VATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP

1 / 2

2 / 2

Previous Next

Peroxiredoxin 6 (PRDX6) Rabbit Monoclonal Antibody [Clone ID: EPR3755]

TA307267

USD 509.00

In Stock

Rabbit monoclonal antibody against Peroxiredoxin 6 (clone EPR3755 )

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Catalase (CAT) Rabbit Polyclonal Antibody

TA337083

USD 410.00

5 Days

Rabbit Polyclonal Catalase Antibody

Applications	IHC, WB
Reactivities	Bovine, Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The catalase enzyme from bovine liver was used as the immunogen.

1 / 2

2 / 2

Previous Next

SHMT2 Rabbit Polyclonal Antibody

TA339281

USD 310.00

5 Days

Rabbit Polyclonal Anti-SHMT2 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-SHMT2 antibody: synthetic peptide directed towards the N terminal of human SHMT2. Synthetic peptide located within the following region: ELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQR

1 / 2

2 / 2

Previous Next

SHMT2 Rabbit Polyclonal Antibody

TA339282

USD 375.00

5 Days

Rabbit Polyclonal Anti-SHMT2 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-SHMT2 antibody: synthetic peptide directed towards the C terminal of human SHMT2. Synthetic peptide located within the following region: ELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDE

1 / 2

2 / 2

Previous Next

Catalase (CAT) Mouse Monoclonal Antibody [Clone ID: OTI1B6]

CF502496

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CAT mouse monoclonal antibody, clone OTI1B6 (formerly 1B6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Catalase (CAT) Mouse Monoclonal Antibody [Clone ID: OTI3C3]

CF502497

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) CAT mouse monoclonal antibody, clone OTI3C3 (formerly 3C3)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Catalase (CAT) Mouse Monoclonal Antibody [Clone ID: OTI1B8]

CF502564

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CAT mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 17

2 / 17

3 / 17

4 / 17

5 / 17

6 / 17

7 / 17

8 / 17

9 / 17

10 / 17

11 / 17

12 / 17

13 / 17

14 / 17

15 / 17

16 / 17

17 / 17

Previous Next

SHMT2 Mouse Monoclonal Antibody [Clone ID: OTI1E12]

CF808813

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SHMT2 mouse monoclonal antibody,clone OTI1E12

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

SHMT2 Mouse Monoclonal Antibody [Clone ID: OTI1E6]

CF808814

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SHMT2 mouse monoclonal antibody,clone OTI1E6

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

SHMT2 Mouse Monoclonal Antibody [Clone ID: OTI3E9]

CF808820

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SHMT2 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

ADH5 Mouse Monoclonal Antibody [Clone ID: OTI5G4]

CF809478

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ADH5 mouse monoclonal antibody,clone OTI5G4

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

ADH5 Mouse Monoclonal Antibody [Clone ID: OTI4D4]

CF809482

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ADH5 mouse monoclonal antibody,clone OTI4D4

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

ADH5 Mouse Monoclonal Antibody [Clone ID: OTI10A10]

CF809490

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ADH5 mouse monoclonal antibody,clone OTI10A10

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Peroxiredoxin 6 (PRDX6) Rabbit Polyclonal Antibody

TA321675

USD 345.00

In Stock

Anti-PRDX6 Rabbit Polyclonal Antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 8-224 amino acids of human peroxiredoxin 6

Peroxiredoxin 6 (PRDX6) Rabbit Polyclonal Antibody

TA321676

USD 345.00

4 Weeks

Anti-PRDX6 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 8-224 amino acids of human peroxiredoxin 6

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Catalase (CAT) Rabbit Polyclonal Antibody

TA349749

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-CAT Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human CAT

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Catalase (CAT) Mouse Monoclonal Antibody [Clone ID: OTI1B6]

TA502496

USD 379.00

In Stock

CAT (Catalase) mouse monoclonal antibody, clone OTI1B6 (formerly 1B6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Catalase (CAT) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B6]

TA502496AM

USD 420.00

4 Weeks

CAT (Catalase) mouse monoclonal antibody, clone OTI1B6 (formerly 1B6), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Biotin

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Catalase (CAT) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B6]

TA502496BM

USD 420.00

4 Weeks

CAT (Catalase) mouse monoclonal antibody, clone OTI1B6 (formerly 1B6), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	HRP

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Catalase (CAT) Mouse Monoclonal Antibody [Clone ID: OTI1B6]

TA502496S

USD 159.00

In Stock

CAT (Catalase) mouse monoclonal antibody, clone OTI1B6 (formerly 1B6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Catalase (CAT) Mouse Monoclonal Antibody [Clone ID: OTI3C3]

TA502497

USD 379.00

In Stock

CAT (Catalase) mouse monoclonal antibody, clone OTI3C3 (formerly 3C3)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Catalase (CAT) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C3]

TA502497AM

USD 420.00

4 Weeks

CAT (Catalase) mouse monoclonal antibody, clone OTI3C3 (formerly 3C3), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Biotin

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Catalase (CAT) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3C3]

TA502497BM

USD 420.00

4 Weeks

CAT (Catalase) mouse monoclonal antibody, clone OTI3C3 (formerly 3C3), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	HRP

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Catalase (CAT) Mouse Monoclonal Antibody [Clone ID: OTI3C3]

TA502497S

USD 159.00

2 Days

CAT (Catalase) mouse monoclonal antibody, clone OTI3C3 (formerly 3C3)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Catalase (CAT) Mouse Monoclonal Antibody [Clone ID: OTI1B8]

TA502564

USD 379.00

In Stock

CAT (Catalase) mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 17

2 / 17

3 / 17

4 / 17

5 / 17

6 / 17

7 / 17

8 / 17

9 / 17

10 / 17

11 / 17

12 / 17

13 / 17

14 / 17

15 / 17

16 / 17

17 / 17

Previous Next

Catalase (CAT) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B8]

TA502564AM

USD 420.00

4 Weeks

CAT (Catalase) mouse monoclonal antibody, clone OTI1B8 (formerly 1B8), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Biotin

• 

1 / 17

2 / 17

3 / 17

4 / 17

5 / 17

6 / 17

7 / 17

8 / 17

9 / 17

10 / 17

11 / 17

12 / 17

13 / 17

14 / 17

15 / 17

16 / 17

17 / 17

Previous Next

Catalase (CAT) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B8]

TA502564BM

USD 420.00

4 Weeks

CAT (Catalase) mouse monoclonal antibody, clone OTI1B8 (formerly 1B8), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	HRP

• 

1 / 17

2 / 17

3 / 17

4 / 17

5 / 17

6 / 17

7 / 17

8 / 17

9 / 17

10 / 17

11 / 17

12 / 17

13 / 17

14 / 17

15 / 17

16 / 17

17 / 17

Previous Next

Catalase (CAT) Mouse Monoclonal Antibody [Clone ID: OTI1B8]

TA502564S

USD 159.00

2 Days

CAT (Catalase) mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 17

2 / 17

3 / 17

4 / 17

5 / 17

6 / 17

7 / 17

8 / 17

9 / 17

10 / 17

11 / 17

12 / 17

13 / 17

14 / 17

15 / 17

16 / 17

17 / 17

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

SHMT2 Mouse Monoclonal Antibody [Clone ID: OTI1E12]

TA808813

USD 379.00

In Stock

SHMT2 mouse monoclonal antibody,clone OTI1E12

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

SHMT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E12]

TA808813AM

USD 420.00

4 Weeks

SHMT2 mouse monoclonal antibody,clone OTI1E12, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

SHMT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E12]

TA808813BM

USD 420.00

4 Weeks

SHMT2 mouse monoclonal antibody,clone OTI1E12, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

SHMT2 Mouse Monoclonal Antibody [Clone ID: OTI1E12]

TA808813S

USD 159.00

2 Days

SHMT2 mouse monoclonal antibody,clone OTI1E12

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

SHMT2 Mouse Monoclonal Antibody [Clone ID: OTI1E6]

TA808814

USD 379.00

In Stock

SHMT2 mouse monoclonal antibody,clone OTI1E6

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

SHMT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E6]

TA808814AM

USD 420.00

4 Weeks

SHMT2 mouse monoclonal antibody,clone OTI1E6, Biotinylated

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

SHMT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E6]

TA808814BM

USD 420.00

4 Weeks

SHMT2 mouse monoclonal antibody,clone OTI1E6, HRP conjugated

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

SHMT2 Mouse Monoclonal Antibody [Clone ID: OTI1E6]

TA808814S

USD 159.00

2 Days

SHMT2 mouse monoclonal antibody,clone OTI1E6

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

SHMT2 Mouse Monoclonal Antibody [Clone ID: OTI3E9]

TA808820

USD 379.00

In Stock

SHMT2 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

SHMT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E9]

TA808820AM

USD 420.00

4 Weeks

SHMT2 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9), Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

SHMT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E9]

TA808820BM

USD 420.00

4 Weeks

SHMT2 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

SHMT2 Mouse Monoclonal Antibody [Clone ID: OTI3E9]

TA808820S

USD 159.00

2 Days

SHMT2 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ADH5 Mouse Monoclonal Antibody [Clone ID: OTI5G4]

TA809478

USD 379.00

In Stock

ADH5 mouse monoclonal antibody,clone OTI5G4

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

ADH5 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5G4]

TA809478AM

USD 420.00

4 Weeks

ADH5 mouse monoclonal antibody,clone OTI5G4, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

ADH5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G4]

TA809478BM

USD 420.00

4 Weeks

ADH5 mouse monoclonal antibody,clone OTI5G4, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

ADH5 Mouse Monoclonal Antibody [Clone ID: OTI5G4]

TA809478S

USD 159.00

2 Days

ADH5 mouse monoclonal antibody,clone OTI5G4

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ADH5 Mouse Monoclonal Antibody [Clone ID: OTI4D4]

TA809482

USD 379.00

In Stock

ADH5 mouse monoclonal antibody,clone OTI4D4

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

ADH5 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4D4]

TA809482AM

USD 420.00

4 Weeks

ADH5 mouse monoclonal antibody,clone OTI4D4, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

1 - 50 of 56 results

Page 1 of 2