Rabbit Polyclonal Anti-GNB1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GNB1 |
Rabbit Polyclonal Anti-GNB1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GNB1 |
GNAT3 / Gustducin Goat Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | GNAT3 / Gustducin antibody was raised against synthetic peptide C-KNQFLDLNLKKEDKE from an internal region of human GNAT3 (NP_001095856.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum (100%); Bat, Lizard (93%); Platypus (87%); Turkey, Chicken (80%). |
Rabbit anti-PRKACB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PRKACB |
Rabbit Polyclonal antibody to GNAS (GNAS complex locus)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 716 and 998 of GNAS (Uniprot ID#Q5JWF2) |
Rabbit polyclonal PKA alpha/beta CAT (Thr197) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKA a/β CAT around the phosphorylation site of threonine 197 (T-W-TP-L-C). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-GluR4 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human GluR4. |
Rabbit polyclonal anti-ADCY5/6 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADCY5/6. |
Rabbit polyclonal anti-PRKX antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PRKX. |
Rabbit Polyclonal antibody to PDE1A (phosphodiesterase 1A, calmodulin-dependent)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 212 and 535 of PDE1A (Uniprot ID#P54750) |
Rabbit polyclonal anti-ADCY8 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADCY8. |
Rabbit polyclonal PKA CAT (Ab-197) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PKA CAT around the phosphorylation site of threonine197 (T-W-TP-L-C). |
G protein alpha S (GNAS) (164-394) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 164 and 394 of Human GNAS |
Rabbit Polyclonal antibody to GNAS (GNAS complex locus)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 807 and 1037 of GNAS (Uniprot ID#Q5JWF2) |
Rabbit Polyclonal anti-GNAS antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV |
T1R1 / TAS1R1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
Applications | IHC |
Reactivities | Gibbon, Bovine, Dog, Gorilla, Horse, Human, Pig |
Conjugation | Unconjugated |
Immunogen | Synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human TAS1R1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Bovine, Cat, Dog, Elephant, Panda, Horse, Pig (100%); Marmoset, Mouse, Rat, Hamster, Rabbit |
Carrier-free (BSA/glycerol-free) PDE1A mouse monoclonal antibody, clone OTI7D5 (formerly 7D5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) GRM4 mouse monoclonal antibody,clone OTI6D1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-GRM4 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 58-70 amino acids of human glutamate receptor, metabotropic 4 |
Anti-GRM4 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 58-70 amino acids of human glutamate receptor, metabotropic 4 |
Anti-TRPM5 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1029-1043 amino acids of human transient receptor potential cation channel, subfamily M, member 5 |
Anti-PRKACG Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 44-298 amino acids of human protein kinase, cAMP-dependent, catalytic, gamma |
Anti-PRKACG Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 44-298 amino acids of human protein kinase, cAMP-dependent, catalytic, gamma |
Anti-GNAS Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 200 amino acids of human GNAS complex locus |
Anti-GNAS Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 200 amino acids of human GNAS complex locus |
Anti-ADCY4 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 808-1077 amino acids of human adenylate cyclase 4 |
Anti-ADCY4 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 808-1077 amino acids of human adenylate cyclase 4 |
Rabbit Polyclonal Anti-KCNB1 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNB1 |
Rabbit Polyclonal Anti-GNAT3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GNAT3 |
PDE1A mouse monoclonal antibody, clone OTI7D5 (formerly 7D5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PDE1A mouse monoclonal antibody, clone OTI7D5 (formerly 7D5), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PDE1A mouse monoclonal antibody, clone OTI7D5 (formerly 7D5), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PDE1A mouse monoclonal antibody, clone OTI7D5 (formerly 7D5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 379.00
In Stock
GRM4 mouse monoclonal antibody,clone OTI6D1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
GRM4 mouse monoclonal antibody,clone OTI6D1, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
GRM4 mouse monoclonal antibody,clone OTI6D1, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
GRM4 mouse monoclonal antibody,clone OTI6D1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".