Antibodies

Jump to Filters
View as table Download
Alpha Fodrin (SPTAN1) Rabbit Polyclonal Antibody
TA344294

USD 475.00

5 Days

Rabbit Polyclonal Anti-SPTAN1 Antibody - N-terminal region

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SPTAN1 antibody: synthetic peptide directed towards the N terminal of human SPTAN1. Synthetic peptide located within the following region: MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ
Alpha Fodrin (SPTAN1) Mouse Monoclonal Antibody [Clone ID: OTI9C10]
CF812019

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SPTAN1 mouse monoclonal antibody,clone OTI9C10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Alpha Fodrin (SPTAN1) Rabbit Polyclonal Antibody
TA351749

USD 345.00

In Stock

Rabbit Polyclonal Anti-SPTAN1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SPTAN1
Alpha Fodrin (SPTAN1) Mouse Monoclonal Antibody [Clone ID: OTI9C10]
TA812019

USD 379.00

In Stock

SPTAN1 mouse monoclonal antibody,clone OTI9C10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Alpha Fodrin (SPTAN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9C10]
TA812019AM

USD 420.00

4 Weeks

SPTAN1 mouse monoclonal antibody,clone OTI9C10, Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Alpha Fodrin (SPTAN1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9C10]
TA812019BM

USD 420.00

4 Weeks

SPTAN1 mouse monoclonal antibody,clone OTI9C10, HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
Alpha Fodrin (SPTAN1) Mouse Monoclonal Antibody [Clone ID: OTI9C10]
TA812019S

USD 159.00

2 Days

SPTAN1 mouse monoclonal antibody,clone OTI9C10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".