Rabbit Polyclonal Anti-AMACR Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human AMACR |
Rabbit Polyclonal Anti-AMACR Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human AMACR |
Rabbit Polyclonal Anti-AMACR Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AMACR antibody: synthetic peptide directed towards the C terminal of human AMACR. Synthetic peptide located within the following region: IFDGTDACVTPVLTFEEVVHHDHNKERGSFITSEEQDVSPRPAPLLLNTP |
Carrier-free (BSA/glycerol-free) AMACR mouse monoclonal antibody,clone OTI2A11
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AMACR mouse monoclonal antibody, clone OTI5G8 (formerly 5G8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AMACR mouse monoclonal antibody,clone OTI5F10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AMACR mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AMACR mouse monoclonal antibody, clone OTI4D12 (formerly 4D12)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AMACR mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AMACR mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Alpha-Methylacyl-CoA Racemase (AMACR, p504s) Mouse Monoclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
AMACR rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human AMACR |
AMACR mouse monoclonal antibody,clone OTI2A11
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
AMACR mouse monoclonal antibody,clone 2A11, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
AMACR mouse monoclonal antibody,clone 2A11, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
AMACR mouse monoclonal antibody,clone OTI2A11
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
AMACR mouse monoclonal antibody, clone OTI5G8 (formerly 5G8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
AMACR mouse monoclonal antibody, clone OTI5G8 (formerly 5G8), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
AMACR mouse monoclonal antibody, clone OTI5G8 (formerly 5G8), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
AMACR mouse monoclonal antibody, clone OTI5G8 (formerly 5G8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
AMACR mouse monoclonal antibody,clone OTI5F10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
AMACR mouse monoclonal antibody,clone 5F10, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
AMACR mouse monoclonal antibody,clone 5F10, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
AMACR mouse monoclonal antibody,clone OTI5F10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
AMACR mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
AMACR mouse monoclonal antibody, clone OTI2E3 (formerly 2E3), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
AMACR mouse monoclonal antibody, clone OTI2E3 (formerly 2E3), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
AMACR mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
AMACR mouse monoclonal antibody, clone OTI4D12 (formerly 4D12)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
AMACR mouse monoclonal antibody, clone OTI4D12 (formerly 4D12), Biotinylated
Applications | IHC |
Reactivities | Human |
Conjugation | Biotin |
AMACR mouse monoclonal antibody, clone OTI4D12 (formerly 4D12), HRP conjugated
Applications | IHC |
Reactivities | Human |
Conjugation | HRP |
AMACR mouse monoclonal antibody, clone OTI4D12 (formerly 4D12)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
AMACR mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
AMACR mouse monoclonal antibody, clone OTI3H10 (formerly 3H10), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
AMACR mouse monoclonal antibody, clone OTI3H10 (formerly 3H10), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
AMACR mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
AMACR mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
AMACR mouse monoclonal antibody, clone OTI3E10 (formerly 3E10), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
AMACR mouse monoclonal antibody, clone OTI3E10 (formerly 3E10), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
AMACR mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
AMACR mouse monoclonal antibody,clone UMAB68
Applications | IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AMACR mouse monoclonal antibody,clone UMAB68
Applications | IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
AMACR mouse monoclonal antibody,clone UMAB214
Applications | 10k-ChIP, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AMACR mouse monoclonal antibody,clone UMAB214
Applications | 10k-ChIP, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
AMACR mouse monoclonal antibody,clone UMAB215
Applications | 10k-ChIP, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AMACR mouse monoclonal antibody,clone UMAB215
Applications | 10k-ChIP, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
AMACR mouse monoclonal antibody,clone UMAB68
Applications | IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
AMACR mouse monoclonal antibody,clone UMAB214
Applications | 10k-ChIP, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
AMACR mouse monoclonal antibody,clone UMAB215
Applications | 10k-ChIP, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".