Antibodies

View as table Download

Rabbit Polyclonal Anti-CD81 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE

TAPA1 (CD81) mouse monoclonal antibody, clone M38, Purified

Applications FC, FN, IF, IHC, IP, WB
Reactivities Feline, Human, Rabbit

Rabbit Polyclonal CD81 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CD81 antibody was raised against a 20 amino acid peptide near the amino terminus of human CD81.

Mouse Monoclonal CD81 Antibody (1D6)

Applications FC, IHC, WB
Reactivities Human, Goat, Primate, Sheep
Conjugation Unconjugated

TAPA1 (CD81) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide

CD81 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD81 (NP_004347.1).
Modifications Unmodified

Recombinant Anti-CD81 (Clone 1D6)

Applications ELISA, FC, IF, IHC, IP, WB
Reactivities Chimpanzee, Goat, Human, Sheep
Conjugation Unconjugated

Recombinant Anti-CD81 (Clone 1D6)

Applications ELISA, FC, IF, IHC, IP, WB
Reactivities Chimpanzee, Goat, Human, Sheep
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques.

Recombinant Anti-CD81 (Clone 1.3.3.22)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Recombinant Anti-CD81 (Clone 1.3.3.22)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques.