Antibodies

Jump to Filters
View as table Download
ACSL5 Rabbit Polyclonal Antibody
TA342006

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACSL5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACSL5 antibody: synthetic peptide directed towards the C terminal of human ACSL5. Synthetic peptide located within the following region: ACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDG
ACSL5 Mouse Monoclonal Antibody [Clone ID: OTI3A3]
CF811897

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACSL5 mouse monoclonal antibody,clone OTI3A3

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
ACSL5 Mouse Monoclonal Antibody [Clone ID: OTI3A3]
TA811897

USD 379.00

In Stock

ACSL5 mouse monoclonal antibody,clone OTI3A3

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
ACSL5 Mouse Monoclonal Antibody [Clone ID: OTI3A3]
TA811897S

USD 159.00

2 Days

ACSL5 mouse monoclonal antibody,clone OTI3A3

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated