ACSL5 Rabbit Polyclonal Antibody

CAT#: TA342006

Rabbit Polyclonal Anti-ACSL5 Antibody

Product Images

WB Suggested Anti-ACSL5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Placenta

• 

  Skeletal muscle

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACSL5 antibody: synthetic peptide directed towards the C terminal of human ACSL5. Synthetic peptide located within the following region: ACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 76 kDa
• Gene Name: acyl-CoA synthetase long-chain family member 5
• Database Link:
  NP_976313
  Entrez Gene 51703 Human
  UniProt ID Q9ULC5
• Background: The protein encoded byThis gene is an isozyme ofThe long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes ofThis family convert free long-chain fatty acids into fatty acyl-CoA esters, andThereby play a key role in lipid biosynthesis and fatty acid degradation.This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas.This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found forThis gene. [provided by RefSeq, Jul 2008]
• Synonyms: ACS2; ACS5; FACL5
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Zebrafish: 93%; Bovine: 92%; Pig: 86%; Horse: 86%; Rabbit: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Adipocytokine signaling pathway, Fatty acid metabolism, Metabolic pathways, PPAR signaling pathway