Rabbit Polyclonal Anti-ACSL5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACSL5 antibody: synthetic peptide directed towards the C terminal of human ACSL5. Synthetic peptide located within the following region: ACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDG |
Goat Polyclonal Antibody against ACSL5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RTQIDSLYEHIQD, from the C Terminus of the protein sequence according to NP_057318.2; NP_976313.1; NP_976314.1. |
Rabbit anti-ACSL5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ACSL5 |
Carrier-free (BSA/glycerol-free) ACSL5 mouse monoclonal antibody,clone OTI1D4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACSL5 mouse monoclonal antibody,clone OTI6B5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ACSL5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 500-739 of human ACSL5 (NP_057318.2). |
| Modifications | Unmodified |
ACSL5 mouse monoclonal antibody,clone OTI1D4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ACSL5 mouse monoclonal antibody,clone OTI1D4, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ACSL5 mouse monoclonal antibody,clone OTI1D4, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ACSL5 mouse monoclonal antibody,clone OTI1D4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ACSL5 mouse monoclonal antibody,clone OTI6B5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ACSL5 mouse monoclonal antibody,clone OTI6B5, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ACSL5 mouse monoclonal antibody,clone OTI6B5, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ACSL5 mouse monoclonal antibody,clone OTI6B5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
