Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ANXA3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANXA3 antibody: synthetic peptide directed towards the N terminal of human ANXA3. Synthetic peptide located within the following region: MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI1F11 (formerly 1F11)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI2F3 (formerly 2F3)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI5G4 (formerly 5G4)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- ANXA3
Applications
- IHC