Antibodies

Jump to Filters
View as table Download
ER81 (ETV1) Rabbit Polyclonal Antibody
AP20524PU-N

USD 370.00

2 Weeks

ER81 (ETV1) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
ER81 (ETV1) Rabbit Polyclonal Antibody
TA343491

USD 375.00

5 Days

Rabbit Polyclonal Anti-ETV1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ETV1 antibody: synthetic peptide directed towards the middle region of human ETV1. Synthetic peptide located within the following region: PDNQRPLLKTDMERHINEEDTVPLSHFDESMAYMPEGGCCNPHPYNEGYV