Antibodies

Jump to Filters
View as table Download
Ferritin Heavy Chain (FTH1) Rabbit Polyclonal Antibody
TA326948

USD 275.00

3 Weeks

Rabbit anti-FTH1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FTH1
Ferritin Heavy Chain (FTH1) (221-232) Goat Polyclonal Antibody
AP22513PU-N

USD 440.00

2 Weeks

Ferritin Heavy Chain (FTH1) (221-232) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Monkey
Immunogen Peptide from the C Terminus of the protein sequence according to NP_002023.2
Ferritin Heavy Chain (FTH1) Rabbit Polyclonal Antibody
TA335033

USD 375.00

5 Days

Rabbit Polyclonal Anti-FTH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FTH1 antibody: synthetic peptide directed towards the middle region of human FTH1. Synthetic peptide located within the following region: NVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKM
Ferritin Heavy Chain (FTH1) Goat Polyclonal Antibody
TA305637

USD 375.00

5 Days

Goat Anti-FTH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DKHTLGDSDNES, from the C Terminus of the protein sequence according to NP_002023.2.
Ferritin Heavy Chain (FTH1) Rabbit Polyclonal Antibody
TA321425

USD 345.00

In Stock

Anti-FTH1 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
Ferritin Heavy Chain (FTH1) Rabbit Polyclonal Antibody
TA321426

USD 345.00

In Stock

Anti-FTH1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein