Antibodies

Jump to Filters
View as table Download
Klotho (KL) Rabbit Polyclonal Antibody
TA319778

USD 430.00

2 Weeks

Rabbit Polyclonal KLOTHO Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KLOTHO antibody was raised against a 16 amino acid synthetic peptide near the center of human KLOTHO.
Klotho (KL) Rabbit Polyclonal Antibody
TA346109

USD 475.00

5 Days

Rabbit Polyclonal Anti-KL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KL antibody: synthetic peptide directed towards the middle region of human KL. Synthetic peptide located within the following region: GRLAPGIRGSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSS
Klotho (KL) Rabbit Polyclonal Antibody
TA346111

USD 475.00

5 Days

Rabbit Polyclonal Anti-KL Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KL antibody: synthetic peptide directed towards the middle region of human KL. Synthetic peptide located within the following region: HAQNGKISIALQADWIEPACPFSQKDKEVAERVLEFDIGWLAEPIFGSGD
Klotho (KL) Goat Polyclonal Antibody
TA311313

USD 375.00

2 Weeks

Goat Anti-Klotho (KL) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KRDDAKYMYYLKK, from the internal region of the protein sequence according to NP_004786.2; NP_710150.1.
Klotho (KL) Rabbit Polyclonal Antibody
TA350910

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-KL Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KL