Antibodies

Jump to Filters
View as table Download
MTUS1 Rabbit Polyclonal Antibody
TA335287

USD 375.00

5 Days

Rabbit Polyclonal Anti-MTUS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTUS1 antibody: synthetic peptide directed towards the middle region of human MTUS1. Synthetic peptide located within the following region: KRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSGSFPSPSISPR
MTUS1 Rabbit Polyclonal Antibody
TA350192

USD 345.00

In Stock

Rabbit Polyclonal Anti-MTUS1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MTUS1
MTUS1 Rabbit Polyclonal Antibody
TA369221

USD 380.00

4 Weeks

MTUS1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MTUS1