MTUS1 Rabbit Polyclonal Antibody

CAT#: TA335287

Rabbit Polyclonal Anti-MTUS1 Antibody

Product Images

MTUS1 antibody - middle region validated by WB using MCF-7, HeLa, and human cancer cell lines at 1: 2000.

• 

  MTUS1 antibody - middle region validated by WB using MCF-7, HeLa, and human cancer cell lines at 1: 2000.

• 

  3Hum. Adult Placenta; Host: Rabbit; Target Name: CHAD; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  4Hum. Fetal Lung; Host: Rabbit; Target Name: NSUN6; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

• 

  5Hum. Fetal Heart; Host: Rabbit; Target Name: GNAS; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0 ug/ml

• 

  6Human HepG2; Host: Rabbit; Target Name: EGFL8; Sample Tissue: HepG2; Antibody Dilution: 1.0 ug/ml.MTUS1 is strongly supported by BioGPS gene expression data to be expressed in HepG2

• 7Hum. Adult Placenta; Host: Rabbit; Target Name: CHAD; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• WB Suggested Anti-MTUS1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Hela cell lysate.MTUS1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells

• Rabbit Anti-MTUS1 Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue; Observed Staining: Cytoplasmic and membrane in cell bodies of pinealocytes and their processes; Primary Antibody Concentration: 1: 100; Other Working Concentrations:

Show all 9 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MTUS1 antibody: synthetic peptide directed towards the middle region of human MTUS1. Synthetic peptide located within the following region: KRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSGSFPSPSISPR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 141 kDa
• Gene Name: microtubule associated tumor suppressor 1
• Database Link:
  NP_001001924
  Entrez Gene 57509 Human
  UniProt ID Q9ULD2
• Background: MTUS1 contains a C-terminal domain and is able to interact with the angiotension II (AT2) receptor and a large coiled-coil region allowing dimerization. One of the isoforms has been shown to be a mitochondrial protein that acts as a tumor suppressor and partcipates in AT2 signaling pathways. Other isoforms may be nuclear or transmembrane proteins but it has not been determined whether they also participate in AT2 signaling pathways. This gene encodes a protein which contains a C-terminal domain able to interact with the angiotension II (AT2) receptor and a large coiled-coil region allowing dimerization. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. One of the transcript variants has been shown to encode a mitochondrial protein that acts as a tumor suppressor and partcipates in AT2 signaling pathways. Other variants may encode nuclear or transmembrane proteins but it has not been determined whether they also participate in AT2 signaling pathways.
• Synonyms: ATBP; ATIP; ICIS; MP44; MTSG1
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Mouse: 93%; Pig: 86%; Rabbit: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors, Transmembrane