Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Podoplanin, (Aggrus, Gp38, OTS-8) syrian hamster anti mouse, clone 8.1.1
| Applications | IHC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PDPN Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PDPN Antibody: synthetic peptide directed towards the N terminal of human PDPN. Synthetic peptide located within the following region: EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVAT |
Mouse Monoclonal Podoplanin Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PDPN Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PDPN |
Podoplanin Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human Podoplanin |
| Modifications | Unmodified |
Podoplanin Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Podoplanin |
PDPN mouse monoclonal antibody,clone OTI3H5
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PDPN mouse monoclonal antibody,clone OTI7B4
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- PDPN
Applications
- IHC