Antibodies

View as table Download

Rabbit Polyclonal RNF39 Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Dog
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal Anti-RNF39 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNF39 antibody: synthetic peptide directed towards the N terminal of human RNF39. Synthetic peptide located within the following region: EGRKAAKVNAGVGEKGIYTASSRGGPPSARSKAVTVVAEGAASRSWLSMD

Carrier-free (BSA/glycerol-free) RNF39 mouse monoclonal antibody, clone OTI5E10 (formerly 5E10)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

RNF39 mouse monoclonal antibody, clone OTI5E10 (formerly 5E10)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

RNF39 mouse monoclonal antibody,clone 5E10, Biotinylated

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Biotin

RNF39 mouse monoclonal antibody,clone 5E10, HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation HRP

RNF39 mouse monoclonal antibody, clone OTI5E10 (formerly 5E10)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated