Rabbit Polyclonal RNF39 Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Dog |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal RNF39 Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Dog |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Anti-RNF39 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RNF39 antibody: synthetic peptide directed towards the N terminal of human RNF39. Synthetic peptide located within the following region: EGRKAAKVNAGVGEKGIYTASSRGGPPSARSKAVTVVAEGAASRSWLSMD |
Carrier-free (BSA/glycerol-free) RNF39 mouse monoclonal antibody, clone OTI5E10 (formerly 5E10)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
RNF39 mouse monoclonal antibody, clone OTI5E10 (formerly 5E10)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
5 Days
RNF39 mouse monoclonal antibody,clone 5E10, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
RNF39 mouse monoclonal antibody,clone 5E10, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
RNF39 mouse monoclonal antibody, clone OTI5E10 (formerly 5E10)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |