Antibodies

View as table Download

LGR8 (RXFP2) (144-158) rabbit polyclonal antibody, Serum

Applications IF, IHC
Reactivities Human
Immunogen Synthetic Human Relaxin Receptor 2 (144-158)

LGR8 (RXFP2) (144-158) rabbit polyclonal antibody, Serum

Applications IF, IHC
Reactivities Human
Immunogen Synthetic Human Relaxin Receptor 2 (144-158)

RXFP2 Antibody

Applications IHC
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence TEVSVLLLTYLTLEKFLVIVFPFSNIRPGKRQTSVILICIWMAGFLIAVI