LGR8 (RXFP2) (144-158) rabbit polyclonal antibody, Serum
Applications | IF, IHC |
Reactivities | Human |
Immunogen | Synthetic Human Relaxin Receptor 2 (144-158) |
LGR8 (RXFP2) (144-158) rabbit polyclonal antibody, Serum
Applications | IF, IHC |
Reactivities | Human |
Immunogen | Synthetic Human Relaxin Receptor 2 (144-158) |
LGR8 (RXFP2) (144-158) rabbit polyclonal antibody, Serum
Applications | IF, IHC |
Reactivities | Human |
Immunogen | Synthetic Human Relaxin Receptor 2 (144-158) |
RXFP2 Antibody
Applications | IHC |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence TEVSVLLLTYLTLEKFLVIVFPFSNIRPGKRQTSVILICIWMAGFLIAVI |