Antibodies

Jump to Filters
View as table Download
TEAD4 Rabbit Polyclonal Antibody
TA308632

USD 415.00

In Stock

Rabbit polyclonal antibody to TEAD4 (TEA domain family member 4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 260 of TEAD4 (Uniprot ID#Q15561)
TEAD4 Rabbit Polyclonal Antibody
TA343373

USD 375.00

5 Days

Rabbit Polyclonal Anti-TEAD4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TEAD4 antibody: synthetic peptide directed towards the C terminal of human TEAD4. Synthetic peptide located within the following region: MMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE