TEAD4 Rabbit Polyclonal Antibody

CAT#: TA343373

Rabbit Polyclonal Anti-TEAD4 Antibody

Product Images

WB Suggested Anti-TEAD4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: 293T cell lysateTEAD4 is supported by BioGPS gene expression data to be expressed in HEK293T

• 

  Host: Rabbit; Target Name: TEAD4; Sample Tissue: 293T; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide; Primary Antibody Concentration: 1 ug/ml; Peptide Concentration: 5 ug/ml; Lysate Quantity: 25 ug/lane/lane; Gel Concentration: 0.1

• 

  Immunohistochemistry with Human Pancrease lysate tissue at an antibody concentration of 5.0 ug/ml using anti-TEAD4 antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TEAD4 antibody: synthetic peptide directed towards the C terminal of human TEAD4. Synthetic peptide located within the following region: MMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: TEA domain transcription factor 4
• Database Link:
  NP_003204
  Entrez Gene 7004 Human
  UniProt ID Q15561
• Background: TEAD4 is a member of the transcriptional enhancer factor (TEF) family. The family members contain the TEA/ATTS DNA-binding domain. TEAD4 is preferentially expressed in skeletal muscle, and binds to the M-CAT regulatory element which directs muscle-specific gene expression. TEAD4 is encoded through the use of a non-AUG (TTG) translation initiation codon. This gene encodes a member of the transcriptional enhancer factor (TEF) family. The family members contain the TEA/ATTS DNA-binding domain. This member is preferentially expressed in skeletal muscle, and binds to the M-CAT regulatory element which directs muscle-specific gene expression. The protein is encoded through the use of a non-AUG (TTG) translation initiation codon. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
• Synonyms: EFTR-2; hRTEF-1B; RTEF1; TCF13L1; TEF-3; TEF3; TEFR-1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Transcription Factors