Antibodies

Jump to Filters
View as table Download
Smad Interacting Protein 1 (ZEB2) Rabbit Polyclonal Antibody
AP01369PU-N

USD 370.00

Please Inquire

Smad Interacting Protein 1 (ZEB2) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide, corresponding to amino acids 71-120 of Human SIP1.
Smad Interacting Protein 1 (ZEB2) Rabbit Polyclonal Antibody
TA349437

USD 380.00

In Stock

Rabbit Polyclonal Anti-ZEB2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ZEB2
Smad Interacting Protein 1 (ZEB2) Rabbit Polyclonal Antibody
TA343754

USD 475.00

5 Days

Rabbit Polyclonal Anti-ZEB2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZEB2 antibody: synthetic peptide directed towards the middle region of human ZEB2. Synthetic peptide located within the following region: LGRQDGDEEFEEEEEESENKSMDTDPETIRDEEETGDHSMDDSSEDGKME
Smad Interacting Protein 1 (ZEB2) Rabbit Polyclonal Antibody
TA312721

USD 345.00

In Stock

Rabbit polyclonal anti-ZEB2 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ZEB2.
Smad Interacting Protein 1 (ZEB2) (C-term) Rabbit Polyclonal Antibody
AP31202PU-N

USD 525.00

2 Weeks

Smad Interacting Protein 1 (ZEB2) (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen ZEB2 antibody was raised against an 18 amino acid synthetic near the carboxy terminus of Human ZEB2.
Smad Interacting Protein 1 (ZEB2) (N-term) Rabbit Polyclonal Antibody
AP31272PU-N

USD 440.00

2 Weeks

Smad Interacting Protein 1 (ZEB2) (N-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide - KLH conjugated
Smad Interacting Protein 1 (ZEB2) Rabbit Polyclonal Antibody
TA334225

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZFHX1B Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ZFHX1B antibody: synthetic peptide directed towards the N terminal of human ZFHX1B. Synthetic peptide located within the following region: NVVDTGSETDEEDKLHIAEDDGIANPLDQETSPASVPNHESSPHVSQALL
Smad Interacting Protein 1 (ZEB2) Rabbit Polyclonal Antibody
TA334226

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZEB2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZEB2 antibody: synthetic peptide directed towards the N terminal of human ZEB2. Synthetic peptide located within the following region: SETDEEDKLHIAEDDGIANPLDQETSPASVPNHESSPHVSQALLPREEEE
Smad Interacting Protein 1 (ZEB2) Mouse Monoclonal Antibody [Clone ID: OTI15G8]
CF802108

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ZEB2 mouse monoclonal antibody, clone OTI15G8 (formerly 15G8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Smad Interacting Protein 1 (ZEB2) Mouse Monoclonal Antibody [Clone ID: OTI1E12]
CF802113

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ZEB2 mouse monoclonal antibody,clone OTI1E12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ZEB2 Rabbit Polyclonal Antibody
TA368878

USD 380.00

4 Weeks

ZEB2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ZEB2
Smad Interacting Protein 1 (ZEB2) Rabbit Polyclonal Antibody
TA383477

USD 220.00

3 Weeks

ZEB2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1050-1214 of human ZEB2 (NP_055610.1).
Modifications Unmodified
Smad Interacting Protein 1 (ZEB2) Mouse Monoclonal Antibody [Clone ID: OTI15G8]
TA802108S

USD 159.00

2 Days

ZEB2 mouse monoclonal antibody, clone OTI15G8 (formerly 15G8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Smad Interacting Protein 1 (ZEB2) Mouse Monoclonal Antibody [Clone ID: OTI1E12]
TA802113

USD 379.00

In Stock

ZEB2 mouse monoclonal antibody,clone OTI1E12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Smad Interacting Protein 1 (ZEB2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E12]
TA802113AM

USD 420.00

5 Days

ZEB2 mouse monoclonal antibody,clone 1E12, Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Smad Interacting Protein 1 (ZEB2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E12]
TA802113BM

USD 420.00

5 Days

ZEB2 mouse monoclonal antibody,clone 1E12, HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
Smad Interacting Protein 1 (ZEB2) Mouse Monoclonal Antibody [Clone ID: OTI1E12]
TA802113S

USD 159.00

In Stock

ZEB2 mouse monoclonal antibody,clone OTI1E12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".