Antibodies

View as table Download

Rabbit Polyclonal TRPC6 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TRPC6 antibody was raised against a 14 amino acid peptide from near the amino terminus of human TRPC6.

Rabbit Polyclonal TRPC6 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TRPC6 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human TRPC6.

Rabbit polyclonal Anti-MCOLN3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCOLN3 antibody: synthetic peptide directed towards the middle region of human MCOLN3. Synthetic peptide located within the following region: ENKLNLTLDFHRLLTVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNK

Rabbit Polyclonal TRPC3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TRPC3 antibody was raised against a 14 amino acid peptide from near the amino terminus of human TRPC3.

Anti-TRPC3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 834-846 amino acids of human transient receptor potential cation channel, subfamily C, member 3

Rabbit Polyclonal Anti-MCOLN3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCOLN3 antibody: synthetic peptide directed towards the middle region of human MCOLN3. Synthetic peptide located within the following region: TVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDI

Rabbit Polyclonal Anti-TRPM6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human TRPM6

Rabbit polyclonal anti-TRPV1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TRPV1