Rabbit Polyclonal TRPC6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | TRPC6 antibody was raised against a 14 amino acid peptide from near the amino terminus of human TRPC6. |
Rabbit Polyclonal TRPC6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | TRPC6 antibody was raised against a 14 amino acid peptide from near the amino terminus of human TRPC6. |
Rabbit Polyclonal TRPC6 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TRPC6 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human TRPC6. |
Rabbit polyclonal Anti-MCOLN3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MCOLN3 antibody: synthetic peptide directed towards the middle region of human MCOLN3. Synthetic peptide located within the following region: ENKLNLTLDFHRLLTVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNK |
Rabbit Polyclonal TRPC3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | TRPC3 antibody was raised against a 14 amino acid peptide from near the amino terminus of human TRPC3. |
Anti-TRPC3 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 834-846 amino acids of human transient receptor potential cation channel, subfamily C, member 3 |
Rabbit Polyclonal Anti-MCOLN3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MCOLN3 antibody: synthetic peptide directed towards the middle region of human MCOLN3. Synthetic peptide located within the following region: TVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDI |
Rabbit Polyclonal Anti-TRPM6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TRPM6 |
Rabbit polyclonal anti-TRPV1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TRPV1 |