Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse anti-PROM1 (CD133) monoclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-LGR5 mouse mAb, clone OTI2A2, bionylated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
USD 399.00
In Stock
Rabbit Polyclonal Anti-EGFLAM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EGFLAM antibody is: synthetic peptide directed towards the C-terminal region of Human EGFLAM. Synthetic peptide located within the following region: TTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSYNLGSGVASIMVNGS |
Rabbit Polyclonal Anti-ARC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ARC |
TA349251 is a possible alternative to TA349500.
Anti-CD36 mouse mAb, clone OTI4H7, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
Rabbit Polyclonal Anti-TMPRSS6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMPRSS6 antibody: synthetic peptide directed towards the N terminal of human TMPRSS6. Synthetic peptide located within the following region: LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK |
Anti-CD36 mouse mAb, clone OTI3F4, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
Anti-CD36 mouse mAb, clone OTI3F4, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
Anti-CD36 mouse mAb, clone OTI4H7, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 524.00
In Stock
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-BDNF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli. |
Goat Polyclonal Anti-CD45 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
Goat Anti-APOL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NNNYKILQADQE, from the C Terminus of the protein sequence according to NP_003652.2; NP_663318.1. |
Active filters
Applications
- WB
Families
- Transmembrane
Availabilities
- In Stock
Filter by
Target Symbol
- KLK8 (97)
- CD4 (78)
- PDCD1 (66)
- ERBB2 (61)
- EGFR (54)
- PECAM1 (51)
- EPCAM (50)
- CD68 (49)
- MSMB (49)
- ABCB1 (48)
- CD5 (42)
- CD99 (41)
- CD274 (40)
- MLANA (39)
- PTPRC (32)
- PROCR (31)
- SYP (31)
- CD19 (30)
- CD44 (30)
- NCAM1 (30)
- TNFRSF8 (28)
- APP (27)
- BTLA (27)
- CD163 (27)
- HAVCR2 (27)
- BCL2 (26)
- LGR5 (26)
- PDCD1LG2 (26)
- CD1C (25)
- CD63 (25)
- KIT (25)
- L1CAM (25)
- RET (25)
- CD33 (24)
- MET (24)
- MS4A1 (24)
- SPG7 (24)
- CD40 (23)
- FGG (23)
- MUC1 (23)
- CD80 (22)
- FGFR2 (22)
- APMAP (21)
- BSG (21)
- FBXW7 (21)
- FCGR2A (21)
- ICAM3 (21)
- MSR1 (21)
- PCDH7 (21)
- PDGFRA (21)
- CD2 (20)
- NPR3 (20)
- PDGFRB (20)
- FATE1 (19)
- HP (19)
- WNT3 (19)
- CD86 (18)
- CDH1 (18)
- CYP1A2 (18)
- FCER2 (18)
- TAPBPL (18)
- UBE2J1 (18)
- ACE2 (17)
- CDH2 (17)
- ERBB3 (17)
- FGFR1 (17)
- MSLN (17)
- MTDH (17)
- NEU1 (17)
- SYT4 (17)
- TNF (17)
- BNIP1 (16)
- CD22 (16)
- CD79B (16)
- CLDN6 (16)
- ENG (16)
- FOLH1 (16)
- IL10RA (16)
- LRRC25 (16)
- MME (16)
- PLAAT3 (16)
- PMEL (16)
- POMK (16)
- CA12 (15)
- CD27 (15)
- CD34 (15)
- GPAT3 (15)
- GPNMB (15)
- MCAM (15)
- MCL1 (15)
- VCAM1 (15)
- ANO1 (14)
- BTN1A1 (14)
- PCDHGC5 (14)
- PTPRE (14)
- RNF149 (14)
- ROR2 (14)
- RPN1 (14)
- SLC2A5 (14)
- ABCC5 (13)
Reactivities
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Cell adhesion molecules (CAMs) (744)
- Cytokine-cytokine receptor interaction (561)
- Hematopoietic cell lineage (534)
- Pathways in cancer (480)
- Focal adhesion (284)
- Endocytosis (283)
- Calcium signaling pathway (248)
- Prostate cancer (236)
- Metabolic pathways (234)
- T cell receptor signaling pathway (223)
- Adherens junction (214)
- MAPK signaling pathway (201)
- Regulation of actin cytoskeleton (198)
- Colorectal cancer (187)
- Leukocyte transendothelial migration (185)
- Neuroactive ligand-receptor interaction (184)
- Primary immunodeficiency (184)
- Melanoma (176)
- ErbB signaling pathway (161)
- Bladder cancer (146)
- Systemic lupus erythematosus (140)
- Pancreatic cancer (139)
- Endometrial cancer (138)
- Jak-STAT signaling pathway (124)
- Apoptosis (123)
- Non-small cell lung cancer (120)
- Alzheimer's disease (119)
- Gap junction (115)
- Toll-like receptor signaling pathway (113)
- Antigen processing and presentation (111)
- Glioma (110)
- Lysosome (109)
- Epithelial cell signaling in Helicobacter pylori infection (107)
- Axon guidance (105)
- Allograft rejection (101)
- Viral myocarditis (98)
- ABC transporters (93)
- Autoimmune thyroid disease (86)
- Amyotrophic lateral sclerosis (ALS) (80)
- Melanogenesis (80)
- Type I diabetes mellitus (78)
- Natural killer cell mediated cytotoxicity (77)
- Olfactory transduction (77)
- Graft-versus-host disease (76)
- Fc gamma R-mediated phagocytosis (75)
- ECM-receptor interaction (70)
- GnRH signaling pathway (70)
- B cell receptor signaling pathway (69)
- Neurotrophin signaling pathway (67)
- Renin-angiotensin system (62)
- SNARE interactions in vesicular transport (59)
- Dorso-ventral axis formation (58)
- Huntington's disease (57)
- Parkinson's disease (56)
- Basal cell carcinoma (55)
- Drug metabolism - cytochrome P450 (53)
- Asthma (52)
- Hypertrophic cardiomyopathy (HCM) (52)
- Tight junction (52)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (51)
- Small cell lung cancer (50)
- Dilated cardiomyopathy (49)
- Thyroid cancer (47)
- Adipocytokine signaling pathway (45)
- Complement and coagulation cascades (44)
- Prion diseases (44)
- Hedgehog signaling pathway (43)
- Wnt signaling pathway (43)
- Retinol metabolism (41)
- Pathogenic Escherichia coli infection (40)
- TGF-beta signaling pathway (40)
- Ubiquitin mediated proteolysis (40)
- Linoleic acid metabolism (39)
- Renal cell carcinoma (34)
- Metabolism of xenobiotics by cytochrome P450 (33)
- N-Glycan biosynthesis (33)
- Oxidative phosphorylation (31)
- RIG-I-like receptor signaling pathway (31)
- Acute myeloid leukemia (30)
- Tryptophan metabolism (29)
- Caffeine metabolism (28)
- PPAR signaling pathway (28)
- Sphingolipid metabolism (27)
- Vascular smooth muscle contraction (27)
- Arachidonic acid metabolism (26)
- Chemokine signaling pathway (26)
- NOD-like receptor signaling pathway (26)
- Fc epsilon RI signaling pathway (25)
- Type II diabetes mellitus (24)
- Fatty acid metabolism (22)
- Nitrogen metabolism (22)
- Chronic myeloid leukemia (19)
- p53 signaling pathway (19)
- Cardiac muscle contraction (17)
- Insulin signaling pathway (17)
- Long-term potentiation (17)
- Other glycan degradation (17)
- Purine metabolism (17)
- Vibrio cholerae infection (17)
- Glycerolipid metabolism (16)
- Notch signaling pathway (16)
- Drug metabolism - other enzymes (15)
- Long-term depression (15)
- Porphyrin and chlorophyll metabolism (15)
- Pyrimidine metabolism (14)
- VEGF signaling pathway (14)
- Keratan sulfate biosynthesis (13)
- Glutathione metabolism (12)
- Glycosphingolipid biosynthesis - lacto and neolacto series (12)
- Progesterone-mediated oocyte maturation (12)
- Ascorbate and aldarate metabolism (11)
- Cytosolic DNA-sensing pathway (11)
- Nicotinate and nicotinamide metabolism (11)
- Oocyte meiosis (11)
- Propanoate metabolism (11)
- Valine (11)
- leucine and isoleucine degradation (11)
- Androgen and estrogen metabolism (10)
- Lysine degradation (10)
- Tyrosine metabolism (10)
- Arginine and proline metabolism (9)
- Butanoate metabolism (9)
- Glycerophospholipid metabolism (9)
- Glycolysis / Gluconeogenesis (9)
- Histidine metabolism (9)
- Limonene and pinene degradation (9)
- Pyruvate metabolism (9)
- Riboflavin metabolism (9)
- Taste transduction (9)
- beta-Alanine metabolism (9)
- Primary bile acid biosynthesis (8)
- Amino sugar and nucleotide sugar metabolism (6)
- Biosynthesis of unsaturated fatty acids (6)
- Ether lipid metabolism (6)
- O-Glycan biosynthesis (6)
- Protein export (4)
- Glycosphingolipid biosynthesis - ganglio series (3)
- Inositol phosphate metabolism (3)
- C21-Steroid hormone metabolism (2)
- Cell cycle (2)
- Cyanoamino acid metabolism (2)
- Pentose and glucuronate interconversions (2)
- Phosphatidylinositol signaling system (2)
- Selenoamino acid metabolism (2)
- Starch and sucrose metabolism (2)
- Steroid biosynthesis (2)
- Taurine and hypotaurine metabolism (2)
- alpha-Linolenic acid metabolism (2)
- Base excision repair (1)
- Chondroitin sulfate biosynthesis (1)
- Glycine (1)
- Glycosphingolipid biosynthesis - globo series (1)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (1)
- Heparan sulfate biosynthesis (1)
- O-Mannosyl glycan biosynthesis (1)
- Sulfur metabolism (1)
- Terpenoid backbone biosynthesis (1)
- serine and threonine metabolism (1)