Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-EGFLAM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EGFLAM antibody is: synthetic peptide directed towards the C-terminal region of Human EGFLAM. Synthetic peptide located within the following region: TTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSYNLGSGVASIMVNGS |
Rabbit Polyclonal Anti-ARC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ARC |
TA349251 is a possible alternative to TA349500.
Rabbit Polyclonal Anti-TMPRSS6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMPRSS6 antibody: synthetic peptide directed towards the N terminal of human TMPRSS6. Synthetic peptide located within the following region: LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK |
USD 524.00
In Stock
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-BDNF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli. |
Goat Polyclonal Anti-CD45 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
Goat Anti-APOL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NNNYKILQADQE, from the C Terminus of the protein sequence according to NP_003652.2; NP_663318.1. |
Rabbit Anti-NMDA NR2B Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Rabbit polyclonal anti-MBTPS1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human MBTPS1. |
Rabbit Polyclonal Anti-NOTCH2 (Cleaved-Ala1734) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NOTCH2 (Cleaved-Ala1734) Antibody: A synthesized peptide derived from human NOTCH2 (Cleaved-Ala1734) |
Goat Polyclonal Anti-CD19 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide within residues 510 aa to the C-terminus of human CD19 produced in E. coli. |
Rabbit Polyclonal Anti-Aqp2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Aqp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ALSIGFSVTLGHLLGIYFTGCSMNPARSLAPAVVTGKFDDHWVFWIGPLV |
Goat Polyclonal Anti-VEGFR2 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from the N-terminus (residues 20-125 aa) of human VEGFR2 produced in E. coli. |
Rabbit polyclonal antibody to QSOX1 (quiescin Q6 sulfhydryl oxidase 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 231 and 617 of QSOX1 (Uniprot ID#O00391) |
Active filters
Reactivities
- Human
Applications
- WB
Isotypes
- IgG
Families
- Transmembrane
Availabilities
- In Stock
Filter by
Target Symbol
- EGFR (18)
- MET (10)
- ERBB2 (9)
- GRIN2B (9)
- PDGFRB (9)
- CSF1R (8)
- FGFR1 (8)
- BCL2L1 (6)
- EPHA2 (6)
- GJA1 (6)
- IGF1R (6)
- NGFR (6)
- APP (5)
- BAX (5)
- CAV1 (5)
- CD19 (5)
- CYP2D6 (5)
- F10 (5)
- HSD17B13 (5)
- INSR (5)
- KDR (5)
- MUC1 (5)
- STX1A (5)
- SYT1 (5)
- CANX (4)
- CD44 (4)
- CLDN1 (4)
- CLDN7 (4)
- ERBB3 (4)
- GLRA1 (4)
- NOTCH2 (4)
- ORAI1 (4)
- PTGER2 (4)
- PTPRC (4)
- ABCC2 (3)
- ABCC3 (3)
- ABCD4 (3)
- ACE (3)
- ADAM17 (3)
- ADRB2 (3)
- APOL1 (3)
- BIK (3)
- BSG (3)
- CA14 (3)
- CASR (3)
- CAV2 (3)
- CCR5 (3)
- CD63 (3)
- CFTR (3)
- COX4I1 (3)
- CSF2RA (3)
- EDNRA (3)
- EPHA3 (3)
- F2R (3)
- GPR171 (3)
- GRIK1 (3)
- GRM3 (3)
- HAVCR1 (3)
- ICAM1 (3)
- IL11RA (3)
- IL2RB (3)
- ITGA6 (3)
- ITGB3 (3)
- KCNA5 (3)
- KIT (3)
- LPAR4 (3)
- MME (3)
- NRG1 (3)
- NTRK2 (3)
- OPN3 (3)
- PECAM1 (3)
- PTPN1 (3)
- RXFP4 (3)
- S1PR1 (3)
- SPAG4 (3)
- TYR (3)
- VCAM1 (3)
- ABCB5 (2)
- ABCB6 (2)
- ACVR2A (2)
- ADAM32 (2)
- ADGRE5 (2)
- ADRA1A (2)
- AGTR1 (2)
- AIFM1 (2)
- ALCAM (2)
- ALDH3A2 (2)
- ALDH6A1 (2)
- ANO1 (2)
- ANTXR1 (2)
- APLNR (2)
- APLP1 (2)
- APLP2 (2)
- APOL2 (2)
- AQP1 (2)
- ARMCX2 (2)
- ARMCX3 (2)
- ARSF (2)
- ASPH (2)
- ATP2A1 (2)
Antibody Hosts
Clonalities
Conjugates
Modifications
Pathways
- Cytokine-cytokine receptor interaction (162)
- Neuroactive ligand-receptor interaction (155)
- Pathways in cancer (132)
- Calcium signaling pathway (99)
- Focal adhesion (90)
- Cell adhesion molecules (CAMs) (86)
- Endocytosis (83)
- Metabolic pathways (79)
- Olfactory transduction (76)
- Regulation of actin cytoskeleton (71)
- Colorectal cancer (67)
- Adherens junction (66)
- Hematopoietic cell lineage (66)
- Melanoma (56)
- Prostate cancer (56)
- MAPK signaling pathway (55)
- Alzheimer's disease (46)
- Leukocyte transendothelial migration (43)
- Axon guidance (41)
- Gap junction (41)
- ErbB signaling pathway (39)
- Pancreatic cancer (37)
- Epithelial cell signaling in Helicobacter pylori infection (36)
- Glioma (36)
- Huntington's disease (32)
- Jak-STAT signaling pathway (32)
- Bladder cancer (31)
- ABC transporters (30)
- Endometrial cancer (30)
- Amyotrophic lateral sclerosis (ALS) (29)
- Apoptosis (29)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (28)
- Melanogenesis (28)
- Non-small cell lung cancer (28)
- Hypertrophic cardiomyopathy (HCM) (26)
- ECM-receptor interaction (25)
- Dilated cardiomyopathy (24)
- Natural killer cell mediated cytotoxicity (24)
- Neurotrophin signaling pathway (24)
- GnRH signaling pathway (23)
- Tight junction (23)
- Dorso-ventral axis formation (22)
- Vascular smooth muscle contraction (22)
- Wnt signaling pathway (22)
- Systemic lupus erythematosus (20)
- SNARE interactions in vesicular transport (19)
- Basal cell carcinoma (18)
- Drug metabolism - cytochrome P450 (17)
- Primary immunodeficiency (17)
- Chemokine signaling pathway (16)
- Long-term potentiation (16)
- Retinol metabolism (16)
- Small cell lung cancer (16)
- Viral myocarditis (16)
- Antigen processing and presentation (14)
- Complement and coagulation cascades (13)
- Renal cell carcinoma (13)
- Fc gamma R-mediated phagocytosis (12)
- Notch signaling pathway (12)
- Parkinson's disease (12)
- B cell receptor signaling pathway (11)
- Lysosome (11)
- Renin-angiotensin system (11)
- T cell receptor signaling pathway (11)
- TGF-beta signaling pathway (11)
- Metabolism of xenobiotics by cytochrome P450 (10)
- Oxidative phosphorylation (10)
- Arachidonic acid metabolism (9)
- Cardiac muscle contraction (9)
- Chronic myeloid leukemia (9)
- Long-term depression (9)
- PPAR signaling pathway (9)
- Pathogenic Escherichia coli infection (9)
- p53 signaling pathway (9)
- Adipocytokine signaling pathway (8)
- Glycerolipid metabolism (8)
- Graft-versus-host disease (8)
- Insulin signaling pathway (8)
- N-Glycan biosynthesis (8)
- Prion diseases (8)
- Type II diabetes mellitus (8)
- Allograft rejection (7)
- Drug metabolism - other enzymes (7)
- Oocyte meiosis (7)
- Progesterone-mediated oocyte maturation (7)
- Taste transduction (7)
- Toll-like receptor signaling pathway (7)
- Vibrio cholerae infection (7)
- Acute myeloid leukemia (6)
- Androgen and estrogen metabolism (6)
- Autoimmune thyroid disease (6)
- Fatty acid metabolism (6)
- Hedgehog signaling pathway (6)
- Primary bile acid biosynthesis (6)
- Type I diabetes mellitus (6)
- Asthma (5)
- Biosynthesis of unsaturated fatty acids (5)
- Glutathione metabolism (5)
- Glycerophospholipid metabolism (5)
- Linoleic acid metabolism (5)
- Nitrogen metabolism (5)
- Thyroid cancer (5)
- Tryptophan metabolism (5)
- Tyrosine metabolism (5)
- VEGF signaling pathway (5)
- Ascorbate and aldarate metabolism (4)
- Caffeine metabolism (4)
- Propanoate metabolism (4)
- Riboflavin metabolism (4)
- Sphingolipid metabolism (4)
- Valine (4)
- leucine and isoleucine degradation (4)
- Ether lipid metabolism (3)
- Fc epsilon RI signaling pathway (3)
- Glycosphingolipid biosynthesis - ganglio series (3)
- Inositol phosphate metabolism (3)
- Keratan sulfate biosynthesis (3)
- Lysine degradation (3)
- Porphyrin and chlorophyll metabolism (3)
- Purine metabolism (3)
- RIG-I-like receptor signaling pathway (3)
- Arginine and proline metabolism (2)
- Butanoate metabolism (2)
- C21-Steroid hormone metabolism (2)
- Cell cycle (2)
- Cyanoamino acid metabolism (2)
- Cytosolic DNA-sensing pathway (2)
- Glycolysis / Gluconeogenesis (2)
- Glycosphingolipid biosynthesis - lacto and neolacto series (2)
- Histidine metabolism (2)
- Limonene and pinene degradation (2)
- O-Glycan biosynthesis (2)
- Pentose and glucuronate interconversions (2)
- Phosphatidylinositol signaling system (2)
- Pyrimidine metabolism (2)
- Pyruvate metabolism (2)
- Selenoamino acid metabolism (2)
- Starch and sucrose metabolism (2)
- Steroid biosynthesis (2)
- Taurine and hypotaurine metabolism (2)
- beta-Alanine metabolism (2)
- Amino sugar and nucleotide sugar metabolism (1)
- Base excision repair (1)
- Chondroitin sulfate biosynthesis (1)
- Glycine (1)
- Glycosphingolipid biosynthesis - globo series (1)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (1)
- Heparan sulfate biosynthesis (1)
- NOD-like receptor signaling pathway (1)
- Nicotinate and nicotinamide metabolism (1)
- O-Mannosyl glycan biosynthesis (1)
- Sulfur metabolism (1)
- Terpenoid backbone biosynthesis (1)
- Ubiquitin mediated proteolysis (1)
- serine and threonine metabolism (1)