Antibodies

View as table Download

Anti-NOS3 Rabbit Polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.1175~1179 (T-Q-S-F-S) derived from Human eNOS.

Anti-PLA2G2A Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 21-144 amino acids of human phospholipase A2, group IIA (platelets, synovial fluid)

Rabbit Polyclonal ERK1/2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ERK1/2

Rabbit Polyclonal ERK1/2 (Thr202/Tyr204) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ERK1/2 around the phosphorylation site of Threonine 202/Tyrosine 204
Modifications Phospho-specific

Rabbit Polyclonal n-NOS (Ser852) Antibody (Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human n-NOS around the phosphorylation site of Serine 852
Modifications Phospho-specific

Rabbit Polyclonal GluR1 (Ser863) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human GluR1 around the phosphorylation site of Serine 863
Modifications Phospho-specific

Rabbit Polyclonal c-PLA2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human c-PLA2

Rabbit polyclonal B-RAF (Ab-446) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human B-RAF around the phosphorylation site of serine 446 (R-D-SP-S-D).

Rabbit polyclonal B-RAF antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human B-RAF.

Rabbit polyclonal RASH/RASK/RASN antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human RASH/RASK/RASN antibody.

Rabbit Polyclonal B-raf Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen B-raf antibody was raised against a 19 amino acid peptide near the center of human B-raf.

MEK2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen C term -peptide of human MEK2

Rabbit anti-NOS1 Polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Recombinant Protein of human NOS1

Rabbit anti-PRKG1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human PRKG1

Rabbit anti-GNA13 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GNA13

Rabbit Polyclonal Anti-GNAQ Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNAQ antibody: synthetic peptide directed towards the N terminal of human GNAQ. Synthetic peptide located within the following region: DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK

Rabbit Polyclonal Anti-PPP2R1B Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP2R1B antibody: synthetic peptide directed towards the N terminal of human PPP2R1B. Synthetic peptide located within the following region: EDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQ

Rabbit Polyclonal Anti-PPP2R1A Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-PPP2R1A antibody is: synthetic peptide directed towards the N-terminal region of HUMAN PPP2R1A. Synthetic peptide located within the following region: IDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVL

Rabbit Polyclonal Anti-PPP2R1A Antibody - middle region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP2R1A antibody: synthetic peptide directed towards the middle region of human PPP2R1A. Synthetic peptide located within the following region: NVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSL

Rabbit Polyclonal Anti-PLA2G5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLA2G5 antibody: synthetic peptide directed towards the N terminal of human PLA2G5. Synthetic peptide located within the following region: MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGW

Rabbit Polyclonal Anti-GNAS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNAS antibody: synthetic peptide directed towards the C terminal of human GNAS. Synthetic peptide located within the following region: YFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCY

Rabbit Polyclonal Anti-CRH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CRH antibody is: synthetic peptide directed towards the C-terminal region of Human CRH. Synthetic peptide located within the following region: GGHQEAPERERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLM

Rabbit Polyclonal Anti-iNOS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-iNOS Antibody: A synthesized peptide derived from human iNOS

Rabbit Polyclonal Anti-RASH/RASK/RASN Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-RASH/RASK/RASN Antibody: A synthesized peptide derived from human RASH/RASK/RASN

Rabbit Polyclonal Anti-GCYB1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GCYB1 Antibody: A synthesized peptide derived from human GCYB1

Rabbit Polyclonal Anti-MAPK1/3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-MAPK1/3 Antibody: A synthesized peptide derived from human MAPK1/3

Rabbit Polyclonal Anti-C-RAF Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-C-RAF Antibody: A synthesized peptide derived from human C-RAF

Rabbit Polyclonal Anti-nNOS Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-nNOS Antibody: A synthesized peptide derived from human nNOS

Rabbit Polyclonal Anti-iNOS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-iNOS Antibody: A synthesized peptide derived from human iNOS

Rabbit Polyclonal Anti-IGF1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-IGF1 antibody: A synthesized peptide derived from human IGF1

Rabbit Polyclonal Anti-Phospho-eNOS(Ser615) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Phospho-eNOS(Ser615) Antibody: A synthesized peptide derived from human eNOS around the phosphorylation site of Sersine 615
Modifications Phospho-specific

Rabbit Polyclonal Anti-Phospho-C-RAF(Ser301) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Phospho-C-RAF(Ser301) Antibody: A synthesized peptide derived from human C-RAF around the phosphorylation site of Sersine 301
Modifications Phospho-specific

Rabbit Polyclonal Anti-Phospho-n-NOS (Ser852) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Phospho-n-NOS (Ser852) Antibody: A synthesized peptide derived from human n-NOS around the phosphorylation site of Serine 852
Modifications Phospho-specific

Rabbit Polyclonal Anti-QSOX1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen QSOX1 antibody was raised against a 17 amino acid peptide near the center of human QSOX1.

Rabbit Polyclonal Antibody against GUCY1A3 (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This Guanylyl Cyclase alpha 1 (GUCY1A3) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 269-300 amino acids from the N-terminal region of human Guanylyl Cyclase alpha 1 (GUCY1A3).

Rabbit Polyclonal Antibody against MAP2K1 (S217)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MEK1(MAP2K1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 196-225 amino acids from human MEK1(MAP2K1).

Rabbit polyclonal antibody to H-Ras (v-Ha-ras Harvey rat sarcoma viral oncogene homolog)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 111 and 189 of H-Ras (Uniprot ID#P01112)

Rabbit Polyclonal antibody to ARAF (v-raf murine sarcoma 3611 viral oncogene homolog)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 371 and 554 of A-RAF (Uniprot ID#P10398)

Goat Anti-IGF1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RSVRAQRHTD, from the internal region of the protein sequence according to NP_001104753.1; NP_001104754.1; NP_001104755.1; NP_000609.1.

Rabbit polyclonal PKC a (Ab-657) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PKC a around the phosphorylation site of tyrosine 657 (F-S-YP-V-N).

Rabbit polyclonal Raf1 (Ab-341) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Raf1 around the phosphorylation site of tyrosine 341 (S-Y-YP-W-E).

Rabbit polyclonal C-RAF (Ser642) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human C-RAF around the phosphorylation site of serine 642 (T-T-SP-P-R).
Modifications Phospho-specific

Rabbit polyclonal anti-PRKCG antibody

Applications WB
Reactivities Human Mouse Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PRKCG.

Rabbit polyclonal anti-A-RAF antibody

Applications WB
Reactivities Human Mouse Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human A-RAF.

Rabbit polyclonal Glutamate receptor 2 (Ab-880) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Glutamate receptor 2 around the phosphorylation site of serine 880 (I-E-S-V-K).

Rabbit polyclonal Glutamate receptor 2 (Ser880) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Glutamate receptor 2 around the phosphorylation site of serine 880 (I-E-SP-V-K).
Modifications Phospho-specific

Rabbit polyclonal anti-GRID2 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GRID2.

Rabbit polyclonal Guanylate Cyclase beta antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Guanylate Cyclase β.

Rabbit polyclonal Enos (Ab-494) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Enos around the phosphorylation site of threonine 494 (K-K-TP-F-K).

Rabbit polyclonal anti-CGK 2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CGK 2.