Rabbit Polyclonal Anti-C7orf16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C7orf16 antibody: synthetic peptide directed towards the middle region of human C7orf16. Synthetic peptide located within the following region: IKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPALHIPPFIPGVFSEH |
Carrier-free (BSA/glycerol-free) PPP1R17 mouse monoclonal antibody,clone OTI2E5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) C7ORF16 mouse monoclonal antibody,clone OTI2A8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PPP1R17 mouse monoclonal antibody,clone OTI2E5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PPP1R17 mouse monoclonal antibody,clone OTI2E5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
C7ORF16 mouse monoclonal antibody,clone OTI2A8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
C7ORF16 mouse monoclonal antibody,clone OTI2A8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China