Antibodies

View as table Download

Rabbit Polyclonal Anti-KV11.1 (HERG) (extracellular)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide AFLLKETEEGPPATEC corresponding to residues 430-445 of human KV11.1 (HERG). Extracellular, between S1 and S2 domains.

Rabbit Polyclonal Anti-hKV11.1 (HERG)

Applications IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GST fusion protein with sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 of human Kv11.1 (HERG). Intracellular, C-terminus.

Rabbit anti-KCNH2 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human KCNH2

Rabbit Polyclonal Anti-KCNH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNH2 antibody: synthetic peptide directed towards the middle region of human KCNH2. Synthetic peptide located within the following region: SQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPG

KCNH2 rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human KCNH2

Anti-KCNH2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 886-899 amino acids of Human potassium voltage-gated channel, subfamily H (eag-related), member 2