Antibodies

Jump to Filters
View as table Download
NR1D1 Mouse Monoclonal Antibody [Clone ID: 4F6]
AM20975PU-N

USD 480.00

2 Weeks

NR1D1 mouse monoclonal antibody, clone 4F6

Applications ELISA, IF, IHC, RNAi, WB
Reactivities Human, Mouse
NR1D1 Rabbit Polyclonal Antibody
TA334242

USD 375.00

5 Days

Rabbit Polyclonal Anti-NR1D1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR1D1 antibody: synthetic peptide directed towards the N terminal of human NR1D1. Synthetic peptide located within the following region: NGSFQSLTQGCPTYFPPSPTGSLTQDPARSFGSIPPSLSDDGSPSSSSSS
NR1D1 Rabbit Polyclonal Antibody
TA338008

USD 375.00

5 Days

Rabbit Polyclonal Anti-NR1D1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR1D1 antibody: synthetic peptide directed towards the middle region of human NR1D1. Synthetic peptide located within the following region: SQVARAHREIFTYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPA