Antibodies

View as table Download

Rabbit Polyclonal Anti-LGALS1 Antibody - middle region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-LGALS1 antibody: synthetic peptide directed towards the middle region of human LGALS1. Synthetic peptide located within the following region: EQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM

Rabbit polyclonal anti-LGALS1 antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human LGALS1.

Galectin 1 (LGALS1) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Gst fusion protein from Human Galectin-1

Goat Anti-Lgals1 / galectin-1 (aa100-112) Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-KLPDGHEFKFPNR, from the internal region of the protein sequence according to NP_032521.1.

Carrier-free (BSA/glycerol-free) LGALS1 mouse monoclonal antibody,clone OTI1E2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LGALS1 mouse monoclonal antibody,clone OTI7C3

Applications WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Anti-LGALS1 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-LGALS1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Galectin 1/LGALS1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human Galectin 1/Galectin 1/LGALS1 (NP_002296.1).
Modifications Unmodified

Galectin 1 Rabbit polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Galectin 1

LGALS1 mouse monoclonal antibody,clone OTI1E2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

LGALS1 mouse monoclonal antibody,clone OTI7C3

Applications WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".